Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.62
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -4.500 7.1e-09
astrocytic glioma -3.200 8.5e-04
Astrocytoma, Pilocytic -4.700 2.7e-14
atypical teratoid / rhabdoid tumor -4.600 3.6e-20
ependymoma -3.500 4.8e-04
glioblastoma -4.400 8.8e-15
group 3 medulloblastoma -3.800 1.3e-06
medulloblastoma, large-cell -4.500 1.0e-08
oligodendroglioma -2.800 8.3e-03
ovarian cancer -1.900 4.0e-08
pituitary cancer 1.800 2.0e-06
primitive neuroectodermal tumor -4.400 5.0e-07

AA Sequence

MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARRQWHHLQVEIE      1 - 70
SLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQEIATYR     71 - 140
HLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEISFTTKVPQKYENENVETVTKQAILNGSIVK    141 - 210
ESTEAHGTIQTEKVDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMR    211 - 280
RSCSIPSIKPPSTAN                                                           281 - 295
//

Text Mined References (6)

PMID Year Title