Property Summary

NCBI Gene PubMed Count 84
PubMed Score 532.94
PubTator Score 5693.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Barrett's esophagus 4.400 3.3e-02
intraductal papillary-mucinous carcinoma... 3.600 2.6e-02
colon cancer -2.400 2.9e-04
interstitial cystitis -3.500 2.9e-03
psoriasis -1.300 9.2e-10

Gene RIF (72)

PMID Text
26670478 K20 expression was detected in 6 of 75 patients with triple-negative carcinoma
26227487 Circulating tumor cell CK20 and survivin expression may effectively predict overall survival in metastic colorectal cancer patients receiving chemotherapy.
26125781 During postoperative follow-up, serum negative CK20 patients had significantly higher 3-year survival rates than serum positive CK20 patients.
25854400 Patients with any EGFR, CK19, CK20 or survinin positivity in their peripheral blood obtain less benefit from radiotherapy.
25643514 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder.
25528628 Our data show that inclusion of CK20 as a biomarker efficiently improves the detection of CTCs in colorectal cancer patients
25081540 Immunostaining of CDX2 and CK20 provides beneficial information if considering whether to perform an endoscopic papillectomy (EP).
24901475 Case Report: Merkel cell carcinma that initially demonstrated cytokeratin 20 positivity but lost expression in subsequent brain metastases.
24403457 High cytokeratin 20 expression is associated with invasive histological phenotype in poorly differentiated colorectal adenocarcinoma.
24025523 The CDX2/CK20 phenotype defines a distinct subgroup of colorectal cancers with microsatellite instability and poor differentiation
23558939 Its association with clinical stage indicates that CK20 might have prognostic value as a marker for detection of circulating CRC cells.
23322277 Overexpression of CK20 is associated with early-onset colorectal cancer.
23150200 Data show that lower survival (OS) and disease-free survival (DFS) rates were significantly associated with guanylate cyclase C (GCC) and CK20 mRNA levels.
22895272 Pouch/peripouch and UC-associated adenocarcinoma had a comparable positive rate for CK7, CK20, and CDX2 by immunohistochemistry.
22752373 High cytokeratin 20 mrna expression is associated with lymphatic metastasis in colon cancer.
22677992 Results suggest that CK20 mRNA with other biomarkers in the peripheral blood of breast cancer patients may be useful to monitor the presence of disseminated tumor cells in the blood circulation and to predict the prognosis of breast cancer.
22414974 CEA mRNA, CK20 mRNA, and serum CEA than patients at stages I-III.
22361037 This is the first reported study of the relationship between CK20/CK7 immunophenotype, BRAF mutations and microsatellite status in colorectal carcinomas
22348416 HER2 and CK20 were seen exclusively in the mucinogenic proliferations in congenital pulmonary airway malformations.
22268990 Both the CK7-/CK20+ phenotype and expression of the antibody CDX2 are highly specific and sensitive markers of colorectal origin.
22237712 Keratin 20 expression is common in colorectal carcinoma.
22119824 The expressions of CK7 and CK20 in nasal polyps were analyzed.
22073364 Cytokeratin 20-positive hepatocellular carcinoma
21938557 positivity rates of CK19 and CK20 in transverse mesocolon were 48.6 and 61.2%, respectively and increased with the depth of tumor invasion
21775107 Merkel cell carcinoma admixed with squamous cell carcinoma can be cytokeratin 20-negative and thyroid transcription factor-1-positive [case report]
21677534 SATB2 in combination with cytokeratin 20 identifies over 95% of all colorectal carcinomas.
21574103 Our results along with the data from the literature indicate that CK7/CK20 expression may be of clinical significance.
21282015 A considerable number of colorectal carcinomas showed no immunoreactivity to CK20.
21106111 The immunohistochemical subtypes based on CK20and MUC1 expression correlated with ampullary tumor progression.
20574624 Case Report: CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis.
20395351 CK20 and VEGF expressions in peripheral blood of colorectal carcinoma patients are promising molecular markers for disease progression and metastasis.
19914229 MMP-11 and CK-20 are probable prognostic markers whose expression reflects the stages of tumor differentiation and LNM of breast cancer.
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19724850 Chromogranin A, synaptophysin and CK 20 were not expressed in any basal cell carcinoma
19664394 CK20 expression is associated with the progression of breast cancer.
19645077 CK20 and CEA are significantly more frequently detected in colon cancer patients than in healthy controls and can serve as markers.
19287335 Data suggest that CD10 and CK20 may be used for the differential diagnosis of MCN and IPMN-BD.
19188603 KRT20 is directly regulated by CDX1, suggesting a role for CDX1 in maintaining differentiation in intestinal epithelial cells
19145500 The expression level of CK20 mRNA in the peripheral blood in patients with gastric cancer declines after postoperative adjuvant chemotherapy.
19119477 CK20 and MUC2 mRNA were quantitated in 52 normal lymph nodes from 12 patients undergoing surgery for benign bowel diseases and in 144 primary colon tumors.
19098678 It can be helpful in cases with metastatic rectal carcinoma, especially those with CK7+/CK20+ or CK20-/CK7- immunophenotype.
19074466 CK20 and CEA are expressed in non-macroscopically involved lymph nodes of colorectal cancer.
18813128 GPC3 is frequently expressed in noncutaneous small cell neuroendocrine carcinoma of various origins, in particular in Merkel cell carcinoma, which, in combination with CK20
18804101 The diagnostic efficacy of urinary CD44 and cytokeratin 20 (CK20) mRNA in comparison with voided urine cytology (VUC) for the detection of bladder cancer, was evaluated.
18705345 Micrometastases of gastric cancer can be detected in circulating peripheral blood using quantitative real-time RT-PCR. CK19 is a better marker than CK18, CK20 and CEA.
18587323 Loss of CDX2 and CK20 is more frequently encountered in mismatch repair-deficient colorectal cancer.
18387990 CK20-positive cells in lymph nodes and circulating mRNA in blood are detected in patients with colorectal neoplasms.
18265645 tumor stage was related to cytokeratin 20 expression in the colorectal cancer patients
18246436 These results indicate that the epithelial barrier of the human adenoid is stably maintained by expression of tight junction proteins in the epithelium including Ck20-positive M-like cells.
18092953 Possible relationship between expression of CK7 and CK20 and neoplastic development of colorectal mucosa in patients with ulcerative colitis.
18072261 Strong immunohistochemical expression of FGFR3, a superficial staining pattern of CK20, and a low proliferative activity define those papillary urothelial neoplasms of low malignant potential that do not recur.
18069772 Positive CK20 RT-PCR, depth of tumor invasion, lymph node status, metastasis and microvessel density are significantly correlated with vascular invasion.
17593078 salivary gland neoplasms showed a CK7+/CK20- immunoprofile ranging from 5 to 100%; squamous carcinoma showed negative CK7/20 immunoexpression
17525485 CK20 is a sensitive and specific marker for Crooke's cells in the anterior pituitary and cytoskeletal changes that occur in corticotrophs in response to hypercortisolism.
17378731 Blood and bone marrow cells in colorectal cancer depleted of CD45 do not show an enrichment of cytokeratin 20 as shown by PCR.
17240035 Dysregulation of CK20 expression is an early event in the carcinogenesis of papillary noninvasive bladder cancer.
16722930 CK20 expression is significntly greater in mucinous cystdenomas than in intraductal papillary mucinous adenomas.
16608857 K20 Ser(13) is a highly dynamic protein kinase C-related phosphorylation site that is induced during apoptosis and tissue injury
16473461 CK 20 mRNA expression in urine has the potential to identify patients at risk for recurrence.
16362976 CK 20 expression defines a subtype of pancreas cancer with important biologic properties; when present, CK 20 expression is an early event in pancreatic carcinogenesis identifiable in precursor lesions
16286979 Overexpressed in recurrent superficial urothelial carcinoma.
15871722 Abnormal CK20 is a useful adjunct to morphology for confirming dysplasia.
15371952 Alteration of CK7 and CK20 expression profile that occurs early in small intestinal tumorigenesis.
14631371 The combined expression of CK7 and CK20 has a low specificity in the distinction between esophageal and cardiac (stomach) adenocarcinomas.
12954496 Down regulation of cytokeratin 20 is associated with transitional and squamous cell carcinoma of the bladder
12894563 It is possible to apply a simple and reliable method for the detection of circulating tumor cells based on cytokeratin-20 and prostate stem cell antigen RT-PCR assays in gastrointestinal cancers.
12636102 CK 20 mRNA identification by RT-PCR is reliable and may be useful for early diagnosis in peritoneal dissemination of colon cancer
12515621 The detection of cancer metastasis in the lymph nodes in colon carcinoma is almost doubled (21.9% vs 11.1%) by CK-20 mRNA
11962749 Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction
11857318 expression pattern is unique to Barrett's esophagus
11844829 expression in lymph nodes correlates with poor prognosis in colorectal cancer
11642721 CK20 expression modified in H. pylori chronic gastritis

AA Sequence

MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNE      1 - 70
KMAMQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQIEELRSQIKDAQLQNAR     71 - 140
CVLQIDNAKLAAEDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQE    141 - 210
EVDGLHKHLGNTVNVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELK    211 - 280
GTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQN    281 - 350
NEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEV    351 - 420
EENI                                                                      421 - 424
//

Text Mined References (87)

PMID Year Title
26670478 2016 Aberrant keratin 7 and 20 expression in triple-negative carcinoma of the breast.
26227487 2015 Cytokeratin-20 and Survivin-Expressing Circulating Tumor Cells Predict Survival in Metastatic Colorectal Cancer Patients by a Combined Immunomagnetic qRT-PCR Approach.
26125781 2015 Predictive value of CK20 in evaluating the efficacy of treatment and prognosis after surgery for colorectal cancer.
25854400 2015 Effects of EGFR, CK19, CK20 and Survinin gene expression on radiotherapy results in patients with locally advanced head and neck cancer.
25643514 2014 Expression of cytokeratin 7, 20, 14 in urothelial carcinoma and squamous cell carcinoma of the Egyprian urinary bladder cancer.
25528628 2015 Cytokeratin 20 improves the detection of circulating tumor cells in patients with colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25081540 2014 Comparison between the location and the histomorphological/immunohistochemical characteristics of noninvasive neoplasms of the ampulla of Vater.
24901475 2014 Loss of cytokeratin 20 and acquisition of thyroid transcription factor-1 expression in a merkel cell carcinoma metastasis to the brain.
24403457 2014 Expression of cytokeratin 20 indicates invasive histological phenotype in poorly differentiated colorectal adenocarcinoma.
24025523 2013 Loss of CDX2/CK20 expression is associated with poorly differentiated carcinoma, the CpG island methylator phenotype, and adverse prognosis in microsatellite-unstable colorectal cancer.
23558939 2013 Detection of cytokeratin-20-positive cells in preoperative and postoperative blood samples from colorectal cancer patients by real-time RT-PCR.
23322277 2013 Overexpression of CK20, MAP3K8 and EIF5A correlates with poor prognosis in early-onset colorectal cancer patients.
23150200 2013 Detection of circulating tumor cells in peripheral blood of colorectal cancer patients without distant organ metastases.
22895272 2012 Histomorphologic and molecular features of pouch and peripouch adenocarcinoma: a comparison with ulcerative colitis-associated adenocarcinoma.
22752373 2012 Prognostic relevance of occult metastases detected by cytokeratin 20 and mucin 2 mRNA levels in sentinel lymph nodes from colon cancer patients.
22677992 CK19, CK20, EGFR and HER2 status of circulating tumor cells in patients with breast cancer.
22414974 2012 Comparative analysis of tumor markers and evaluation of their predictive value in patients with colorectal cancer.
22361037 2012 Aberrant pattern of the cytokeratin 7/cytokeratin 20 immunophenotype in colorectal adenocarcinomas with BRAF mutations.
22348416 2012 MUC5AC, cytokeratin 20 and HER2 expression and K-RAS mutations within mucinogenic growth in congenital pulmonary airway malformations.
22268990 2012 The value of CDX2 and cytokeratins 7 and 20 expression in differentiating colorectal adenocarcinomas from extraintestinal gastrointestinal adenocarcinomas: cytokeratin 7-/20+ phenotype is more specific than CDX2 antibody.
22237712 2012 Keratin 20 - a diagnostic and prognostic marker in colorectal cancer?
22119824 2011 Expression pattern of CK7 and CK20 in nasal polyps, at patients with chronic rhinosinusitis with nasal polyposis.
22073364 2009 Cytokeratin 20-positive hepatocellular carcinoma.
21938557 2012 Expression and clinical significance of CK19 and CK20 expressions in transverse mesocolon biopsies from patients with gastric carcinoma.
21775107 2011 Merkel cell carcinoma with cytokeratin 20-negative and thyroid transcription factor-1-positive immunostaining admixed with squamous cell carcinoma.
21677534 2011 SATB2 in combination with cytokeratin 20 identifies over 95% of all colorectal carcinomas.
21574103 2011 Cytokeratin 7 and 20 expression in gallbladder carcinoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21282015 2011 Cytokeratin 7 and cytokeratin 20 expression in colorectal adenocarcinomas.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21106111 2010 Cytokeratin 20 (CK20) and apomucin 1 (MUC1) expression in ampullary carcinoma: Correlation with tumor progression and prognosis.
20574624 2010 CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis.
20395351 2011 Cytokeratin 20 and vascular endothelial growth factor as molecular markers in Egyptian patients with colorectal cancer.
19914229 2010 The clinical implications of MMP-11 and CK-20 expression in human breast cancer.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19724850 2009 Aberrant expression of class III beta-tubulin in basal cell carcinoma of the skin.
19664394 2009 [Association of CK20 expression with the progression, metastasis and prognosis of breast cancer].
19645077 2009 Detection of epithelial cells by RT-PCR targeting CEA, CK20, and TEM-8 in colorectal carcinoma patients using OncoQuick density gradient centrifugation system.
19287335 2009 Comparison between mucinous cystic neoplasm and intraductal papillary mucinous neoplasm of the branch duct type of the pancreas with respect to expression of CD10 and cytokeratin 20.
19188603 2009 Gastrointestinal differentiation marker Cytokeratin 20 is regulated by homeobox gene CDX1.
19145500 2009 [Expression of CK20 mRNA in the peripheral blood around postoperative chemotherapy in patients with gastric cancer and its clinical significance].
19119477 2009 The potential of cytokeratin 20 and mucin 2 mRNA as metastasis markers in regional lymph nodes of colon cancer patients investigated by quantitative RT-PCR.
19098678 2009 CDX2, cytokeratins 7 and 20 immunoreactivity in rectal adenocarcinoma.
19074466 2009 Added value of combined gene and protein expression of CK20 and CEA in non-macroscopically involved lymph nodes of colorectal cancer.
18813128 2009 Frequent expression of glypican-3 in Merkel cell carcinoma: an immunohistochemical study of 55 cases.
18804101 2008 Comparison of CD44 and cytokeratin 20 mRNA in voided urine samples as diagnostic tools for bladder cancer.
18705345 Detection of circulating gastric cancer cells in peripheral blood using real time quantitative RT-PCR.
18587323 2008 Differential diagnostic and functional role of the multi-marker phenotype CDX2/CK20/CK7 in colorectal cancer stratified by mismatch repair status.
18387990 2008 Isolated tumor cells and circulating CK20 mRNA in pN0 colorectal cancer patients.
18265645 2007 Mismatch repair protein MSH2, cytokeratin 18 and cytokeratin 20 expression: clinicopathological correlation and prognostic value in colorectal cancer patients.
18246436 2008 Expression of tight junction proteins in epithelium including Ck20-positive M-like cells of human adenoids in vivo and in vitro.
18092953 2007 Altered expression of CK7 and CK20 in preneoplastic and neoplastic lesions in ulcerative colitis.
18072261 2008 Strong immunohistochemical expression of fibroblast growth factor receptor 3, superficial staining pattern of cytokeratin 20, and low proliferative activity define those papillary urothelial neoplasms of low malignant potential that do not recur.
18069772 2007 Relationship between vascular invasion and microvessel density and micrometastasis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17593078 2007 CK7+/CK20- immunoexpression profile is typical of salivary gland neoplasia.
17525485 2006 Cytokeratin CK20 is a sensitive marker for Crooke's cells and the early cytoskeletal changes associated with hypercortisolism within pituitary corticotrophs.
17378731 2007 Immunomagnetic CD45 depletion does not improve cytokeratin 20 RT-PCR in colorectal cancer.
17240035 2007 FGFR3 mutations and a normal CK20 staining pattern define low-grade noninvasive urothelial bladder tumours.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16831889 2006 New consensus nomenclature for mammalian keratins.
16722930 2006 Human pancreatic mucinous cystadenoma is characterized by distinct mucin, cytokeratin and CD10 expression compared with intraductal papillary-mucinous adenoma.
16608857 2006 Keratin 20 serine 13 phosphorylation is a stress and intestinal goblet cell marker.
16473461 2007 Urinary cytokeratin 20 mRNA expression has the potential to predict recurrence in superficial transitional cell carcinoma of the bladder.
16362976 2006 Cytokeratin 20 expression identifies a subtype of pancreatic adenocarcinoma with decreased overall survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286979 2005 Cytokeratin 20, 34betaE12 and overexpression of HER-2/neu in urine cytology as predictors of recurrences in superficial urothelial carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15871722 2005 Utility of cytokeratin 20 and Ki-67 as markers of urothelial dysplasia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371952 2004 Alteration of cytokeratin 7 and cytokeratin 20 expression profile is uniquely associated with tumorigenesis of primary adenocarcinoma of the small intestine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14631371 2004 Identical cytokeratin expression pattern CK7+/CK20- in esophageal and cardiac cancer: etiopathological and clinical implications.
12954496 Cytokeratin 20, AN43, PGDH, and COX-2 expression in transitional and squamous cell carcinoma of the bladder.
12894563 Detection of circulating tumor cells by cytokeratin 20 and prostate stem cell antigen RT-PCR in blood of patients with gastrointestinal cancers.
12857878 2003 Keratin 20 helps maintain intermediate filament organization in intestinal epithelia.
12636102 2002 Detection of peritoneal micrometastases by reverse transcriptase-polymerase chain reaction targeting carcinoembryonic antigen and cytokeratin 20 in colon cancer patients.
12515621 2002 [Significance of cytokeratin gene (CK-20 mRNA) expression in metastatic lymph nodes in colon carcinoma patients].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11962749 2002 Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.
10973561 2000 An immunohistological study of cytokeratin 20 in human and mammalian oral epithelium.
8359595 1993 The human gene encoding cytokeratin 20 and its expression during fetal development and in gastrointestinal carcinomas.
7689500 1993 Differential localization by in situ hybridization of distinct keratin mRNA species during intestinal epithelial cell development and differentiation.
1696264 1990 Identification of protein IT of the intestinal cytoskeleton as a novel type I cytokeratin with unusual properties and expression patterns.