Property Summary

NCBI Gene PubMed Count 77
PubMed Score 246.97
PubTator Score 260.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Palmoplantar keratosis 36 0.0 4.0
Disease Target Count
Pachyonychia congenita 2 1

Expression

  Differential Expression (27)

Disease log2 FC p
interstitial lung disease 2.800 4.7e-02
malignant mesothelioma 3.400 8.6e-08
astrocytic glioma -1.100 1.6e-02
ependymoma -1.200 2.2e-02
oligodendroglioma -1.100 1.8e-02
Barrett's esophagus 2.000 2.6e-02
psoriasis 2.000 1.5e-44
cutaneous lupus erythematosus 1.800 1.4e-03
osteosarcoma 1.488 8.7e-04
cystic fibrosis -4.354 2.6e-08
atypical teratoid / rhabdoid tumor -1.300 5.7e-06
glioblastoma -1.200 2.6e-05
medulloblastoma, large-cell -1.300 3.0e-03
primitive neuroectodermal tumor -1.400 4.2e-04
primary pancreatic ductal adenocarcinoma 3.148 1.4e-03
non-small cell lung cancer 4.867 1.7e-14
colon cancer 2.100 8.6e-04
pancreatic cancer 3.000 6.9e-06
breast carcinoma -2.300 3.4e-21
group 4 medulloblastoma -1.300 3.2e-04
pilocytic astrocytoma -1.200 1.5e-05
primary Sjogren syndrome -1.400 5.0e-02
lung adenocarcinoma 1.600 5.7e-03
Breast cancer -4.300 4.0e-20
spina bifida -1.687 3.6e-02
ulcerative colitis 1.300 1.7e-02
ovarian cancer 2.300 5.5e-05

Gene RIF (48)

PMID Text
26740287 Cytokeratin 17 immunoexpression might have a role in evaluating surgical borders in some cases of actinic keratosis and Bowen disease.
26191283 These findings suggest that CK17 is involved in the development and metastasis of papillary thyroid carcinoma
26168014 Data indicate that autoimmune regulator Aire mRNA transcripts are regulated in a keratin 17 (K17) dependent manner in skin tumor keratinocytes.
26165312 Steatocystoma multiplex is associated with the R94C mutation in the KRTl7 gene, and is reported in a Chinese pedigree.
26109559 our findings establish that K17 functions specially among keratins as an oncoprotein by controlling the ability of p27(KIP1) to influence cervical cancer pathogenesis.
25736868 We conclude that K17 expression promotes oral squamous cell carcinoma cell growth and cell size but does not affect cell migration
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25111597 Case Report: polycystic kidney disease with steatocystoma multiplex. PKD1 mutations disrupt keratin 17 polymerization.
24471966 keratin14 expression can be used to detect early epithelial dysplasia, and that keratin13 and keratin17 expression are useful for detecting neoplastic changes
24335642 Peripheral or diffuse staining for CK17 is a useful marker of invasion in anal squamous neoplastic lesions.
24247036 Immunoexpression of CK13 and CK17 in light green-stained superficial cells was associated with more severe morphological atypia in tongue squamous cell carcinoma
24168496 BerEp4 alone is unreliable for differentiation between BCCm (basal cell carcinoma with squamous metaplasia) and bSCC (basaloid squamous cell carcinoma). The addition of either CK14 or CK17 will augment BCCm versus bSCC differential diagnosis.
24051697 Report overexpression of keratin 17 in premalignant and malignant squamous lesions of the cervix.
24043308 KRT17 is necessary for oncogenic transformation in Ewing sarcoma and accounts for much of the GLI1-mediated transformation function but via a mechanism independent of AKT signaling.
23855588 novel heterozygous mutation, p.L91P (c.272T>C) in the helix initiation motif, associated with pachyonychia congenita type 2
23430585 Overexpression of keratin 17 is associated with epithelial ovarian cancer.
23278621 a novel mutation in a Chinese pedigree of pachyonychia congenita type 2 with typical clinical presentations and an autosomal dominant inheritance pattern
22808266 IL-22 up-regulates K17 expression in keratinocytes in a dose-dependent manner through STAT3- and ERK1/2-dependent mechanisms.
22795618 Keratin 17 is a therapeutic target for the treatment of psoriasis [review]
22695933 Keratin-17 expression is correlated with tumor progression in gastric adenocarcinoma and may serve as a biomarker for poor prognosis.
22639854 We identified a known mutation in the KRT17 gene in a family with steatocystoma
22466643 Data indicate that cytokeratin 17 (CK17) expression could be associated with the differentiation and the malignancy of oral squamous cell carcinoma (OSCC).
22336949 A report on homozygosity for dominant missense mutations in keratin 17 that modify the pachyonychia congenita phenotype.
22264670 We observed a higher likelihood of oral leukokeratosis in individuals harboring KRT6A mutations, and a strong association of natal teeth and cysts in carriers of a KRT17 mutation.
22235123 a novel interaction involving K17 and AnxA2 and identify AnxA2 as a potential regulator of keratin filaments.
22076435 Both moesin and KRT17 demonstrated a tendency of increased expression as pT stage advanced.
22006917 Type I keratin 17 protein is phosphorylated on serine 44 by p90 ribosomal protein S6 kinase 1 (RSK1) in a growth- and stress-dependent fashion
21796151 The data suggested that IL-17A can upregulate keratin-17 expression in keratinocytes in a dose-dependent manner through STAT1- and STAT3-dependent mechanisms.
21443102 KRT17 is upregulated in gastric adenocarcinoma and is associated with tumor progression.
21356351 AIRE expression in HaCaT epidermal keratinocytes, as well as its interaction with K17, was confirmed.
21287500 mutation of KRT17 may play a major role in the pathogenesis of this pedigree with pachyonychia congenita type 2.
19882246 Overexpression of KRT17 is associated with basal-like phenotype in breast cancer.
19701759 higher expression in the fetal skin than in adult skin
19558792 Increased expression of keratins in endothelial cells, such as keratin 17, may contribute to the angiogenesis induced by HepG2 cells.
19470054 two novel missense mutations of K17 in two Chinese families with steatocystoma multiplex
19460752 Knockdown of keratin 17 (KRT17) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19366057 Positive staining for CK5/6 or CK17 was associated with a worse prognosis, high tumor grade and positive axillary lymph nodes.
19107515 An N92S (p.Asn92Ser) germline keratin 17 gene mutation in a pachyonychia congenita type 2 female patient is presented.
19102940 Positive expression of CK5/6 or CK17 in patients with triple-negative breast cancer is correlated with poor prognosis, high grade differentiation and axillary lymph node metastasis.
18936942 human ScFv against keratin 17 can inhibit the proliferation of keratinocytes
18547302 The mutation p.M88K is in the helix initiation motif (HIM) of KRT17, where 13 of the reported 14 mutations of KRT17 in PC-2 have been mapped, and the residue M88 of the HIM is also a mutation hotspot of other keratin disorders (http://www.interfil.org/).
17786476 findings showed that out of all cytokeratins, CK17 was up-regulated strongest in oral squamous cell carcinoma compared to normal samples, and over-expression was most significantly associated with diagnosis
17719747 Four new missense and five known mutations in K6a, one new deletion and three previously identified missense mutations in K16, plus one known mutation in K17 are reported in pachyonychia congenita.
16638858 KRT 17 seemed to be the most accurate marker for the diagnosis of micrometastases of a size >450 mum.
15795121 Epitopes S1 (118-132), S2 (169-183), S4 (323-337) and S4 (348-362) are immunodominant DR B1-restricted T cell epitopes for psoriasis. S1 (118-132) contains the ALEEAN sequence. Others with different amino acid sequence have not been reported before.
15102078 Mutation in second half of 1A domain of K17 might delay onset of clinical phenotype.
14761598 CK17 expression is significantly higher in thyroid papillary carcinoma than benign thyroid tissue; and this characteristic can have important diagnostic value.
12466114 expression in breast cancer cells was associated with a poor clinical outcome

AA Sequence

MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYG      1 - 70
SSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEE     71 - 140
LQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIEN    141 - 210
LKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTE    211 - 280
ELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE    281 - 350
EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV    351 - 420
ISSREQVHQTTR                                                              421 - 432
//

Text Mined References (95)

PMID Year Title
26740287 2016 Cytokeratin 17 immunoexpression in actinic keratosis (bowenoid and nonbowenoid) and in Bowen disease.
26191283 2015 Overexpression of cytokeratin 17 is associated with the development of papillary thyroid carcinoma and the presence of lymph node metastasis.
26168014 2015 Keratin-dependent regulation of Aire and gene expression in skin tumor keratinocytes.
26165312 2015 Steatocystoma multiplex is associated with the R94C mutation in the KRTl7 gene.
26109559 2015 Keratin-17 Promotes p27KIP1 Nuclear Export and Degradation and Offers Potential Prognostic Utility.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25736868 2015 Keratin 17 is co-expressed with 14-3-3 sigma in oral carcinoma in situ and squamous cell carcinoma and modulates cell proliferation and size but not cell migration.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25111597 2015 Polycystic kidney disease with steatocystoma multiplex: evidences for a disruptive effect of mutated polycystin-1 on keratin 17 polymerisation.
24471966 2014 Immunohistochemical staining patterns of cytokeratins 13, 14, and 17 in oral epithelial dysplasia including orthokeratotic dysplasia.
24335642 2014 Cytokeratin 17: an adjunctive marker of invasion in squamous neoplastic lesions of the anus.
24247036 2014 Evaluation of superficial oral squamous cell malignancy based on morphometry and immunoexpression of cytokeratin 13 and cytokeratin 17.
24168496 2013 BerEp4, cytokeratin 14, and cytokeratin 17 immunohistochemical staining aid in differentiation of basaloid squamous cell carcinoma from basal cell carcinoma with squamous metaplasia.
24051697 2014 Keratin 17 in premalignant and malignant squamous lesions of the cervix: proteomic discovery and immunohistochemical validation as a diagnostic and prognostic biomarker.
24043308 2013 A novel role for keratin 17 in coordinating oncogenic transformation and cellular adhesion in Ewing sarcoma.
23855588 2013 Novel mutation (p.L91P, c.272T>C) of keratin 17 in a case with pachyonychia congenita type 2.
23430585 2013 Overexpression of keratin 17 is associated with poor prognosis in epithelial ovarian cancer.
23278621 2013 A novel mutation of keratin 17 gene in a pedigree with pachyonychia congenita type 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808266 2012 The pro-inflammatory cytokine IL-22 up-regulates keratin 17 expression in keratinocytes via STAT3 and ERK1/2.
22795618 2012 Keratin 17 as a therapeutic target for the treatment of psoriasis.
22695933 2012 Keratin 17 expression correlates with tumor progression and poor prognosis in gastric adenocarcinoma.
22639854 2012 Steatocystoma multiplex: keratin 17 - the key player?
22466643 2012 Association of cytokeratin 17 expression with differentiation in oral squamous cell carcinoma.
22336949 2012 Homozygous dominant missense mutation in keratin 17 leads to alopecia in addition to severe pachyonychia congenita.
22264670 2012 A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita.
22235123 2012 Identification of novel interaction between annexin A2 and keratin 17: evidence for reciprocal regulation.
22076435 2012 Proteomic analysis reveals overexpression of moesin and cytokeratin 17 proteins in colorectal carcinoma.
22006917 2011 Type I keratin 17 protein is phosphorylated on serine 44 by p90 ribosomal protein S6 kinase 1 (RSK1) in a growth- and stress-dependent fashion.
21796151 2011 IL-17A upregulates keratin 17 expression in keratinocytes through STAT1- and STAT3-dependent mechanisms.
21443102 Identification of potential biomarkers for early and advanced gastric adenocarcinoma detection.
21356351 2011 The autoimmune regulator (AIRE), which is defective in autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy patients, is expressed in human epidermal and follicular keratinocytes and associates with the intermediate filament protein cytokeratin 17.
21326300 2011 A large mutational study in pachyonychia congenita.
21287500 2011 [Keratin 17 mutation in pachyonychia congenita type 2 in a Chinese Han family].
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19882246 2010 BRCA1 transcriptionally regulates genes associated with the basal-like phenotype in breast cancer.
19701759 2010 Comparison between human fetal and adult skin.
19558792 2009 Keratin 17 identified by proteomic analysis may be involved in tumor angiogenesis.
19470054 2009 Novel missense mutation of keratin in Chinese family with steatocystoma multiplex.
19366057 Basal cytokeratin expression in relation to immunohistochemical and clinical characterization in breast cancer patients with triple negative phenotype.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19107515 2009 Pachyonychia congenita type 2, N92S mutation of keratin 17 gene: clinical features, mutation analysis and pathological view.
19102940 2008 [Expression of CK5/6 and CK17 and its correlation with prognosis of triple-negative breast cancer patients].
18936942 2009 Secretory expression of human ScFv against keratin in Pichia pastoris and its effects on cultured keratinocytes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18547302 2008 A novel point mutation of keratin 17 (KRT17) in a Japanese family with pachyonychia congenita type 2: an RNA-based genetic analysis using a single hair bulb.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17786476 2008 Cytokeratin 17 mRNA expression has potential for diagnostic marker of oral squamous cell carcinoma.
17719747 2007 A spectrum of mutations in keratins K6a, K16 and K17 causing pachyonychia congenita.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16831889 2006 New consensus nomenclature for mammalian keratins.
16713453 2006 Altered keratin 17 peptide ligands inhibit in vitro proliferation of keratinocytes and T cells isolated from patients with psoriasis.
16638858 2006 The diagnostic accuracy of reverse transcription-PCR quantification of cytokeratin mRNA in the detection of sentinel lymph node invasion in oral and oropharyngeal squamous cell carcinoma: a comparison with immunohistochemistry.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16620218 2006 Keratin 17 mutation in pachyonychia congenita type 2 patient with early onset steatocystoma multiplex and Hutchinson-like tooth deformity.
16250206 2005 The genetic basis of pachyonychia congenita.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15795125 2005 Identification of a recurrent mutation in keratin 17 in a Japanese family with pachyonychia congenita type 2.
15795121 2005 HLA DR B1*04, *07-restricted epitopes on Keratin 17 for autoreactive T cells in psoriasis.
15608502 Interferon-gamma-dependent in vitro model for the putative keratin 17 autoimmune loop in psoriasis: exploration of pharmaco- and gene-therapeutic effects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15102078 2004 A novel mutation in the second half of the keratin 17 1A domain in a large pedigree with delayed-onset pachyonychia congenita type 2.
14761598 2003 [Expression of cytokeratins and ret in thyroid papillary carcinoma].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466114 2002 Expression of cytokeratins 17 and 5 identifies a group of breast carcinomas with poor clinical outcome.
12429849 2002 Functional proteomic analysis of human nucleolus.
11886499 2001 Novel and recurrent mutations in the genes encoding keratins K6a, K16 and K17 in 13 cases of pachyonychia congenita.
11874497 2002 A novel point mutation in the keratin 17 gene in a Japanese case of pachyonychia congenita type 2.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11348474 2001 Novel keratin 17 mutations in pachyonychia congenita type 2.
10844551 2000 Keratin 17 expression in the hard epithelial context of the hair and nail, and its relevance for the pachyonychia congenita phenotype.
10651700 2000 Keratin expression in the normal nail unit: markers of regional differentiation.
10571744 1999 Mutation report: identification of a germline mutation in keratin 17 in a family with pachyonychia congenita type 2.
10341211 1999 Human sweat gland myoepithelial cells express a unique set of cytokeratins and reveal the potential for alternative epithelial and mesenchymal differentiation states in culture.
9786956 1998 Onset of keratin 17 expression coincides with the definition of major epithelial lineages during skin development.
9767294 1998 Keratin 17 mutations cause either steatocystoma multiplex or pachyonychia congenita type 2.
9008238 1997 Missense mutations in keratin 17 cause either pachyonychia congenita type 2 or a phenotype resembling steatocystoma multiplex.
7577575 1995 Keratins (K16 and K17) as markers of keratinocyte hyperproliferation in psoriasis in vivo and in vitro.
7539673 1995 Keratin 16 and keratin 17 mutations cause pachyonychia congenita.
7529318 1994 A gene for pachyonychia congenita is closely linked to the keratin gene cluster on 17q12-q21.
7523421 1994 Increased expression of keratin 16 causes anomalies in cytoarchitecture and keratinization in transgenic mouse skin.
2481679 1989 Patterns of expression of keratin 17 in human epithelia: dependency on cell position.
1690428 1990 Keratins as markers that distinguish normal and tumor-derived mammary epithelial cells.
1372562 1992 Interferon-gamma regulates expression of a novel keratin class I gene.
1281771 1992 Characterization of the human gene encoding cytokeratin 17 and its expression pattern.