Property Summary

NCBI Gene PubMed Count 97
PubMed Score 264.92
PubTator Score 653.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
periodontitis 293 7.1e-07
osteosarcoma 7950 7.3e-03
esophageal adenocarcinoma 737 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Epidermolytic hyperkeratosis 14 0.0 5.0

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -2.700 2.0e-02
osteosarcoma -2.435 7.3e-03
periodontitis -1.200 7.1e-07

Gene RIF (34)

AA Sequence

MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGGGFGSRSLVNL      1 - 70
GGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYG     71 - 140
GGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSREREQIKSLNNQFASFIDKVRFLEQQNQVLQT    141 - 210
KWELLQQVDTSTRTHNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNA    211 - 280
ENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSI    281 - 350
IAEVKAQYEDIAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS    351 - 420
NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEE    421 - 490
SRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSYG    491 - 560
SGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKSSGGSS    561 - 630
SVKFVSTTYSGVTR                                                            631 - 644
//

Text Mined References (112)

PMID Year Title