Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.40
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.200 4.9e-04
osteosarcoma 1.652 7.8e-06
glioblastoma 1.200 1.0e-02
medulloblastoma, large-cell 1.300 3.4e-05
primitive neuroectodermal tumor 1.300 2.6e-04
intraductal papillary-mucinous adenoma (... 1.200 2.1e-02
lung cancer 1.100 3.7e-03
active Crohn's disease 1.037 6.6e-03
pediatric high grade glioma 1.400 3.8e-06
ovarian cancer 1.900 4.8e-06

 GO Function (1)

Gene RIF (7)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21358275 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15832179 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
7505766 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREA      1 - 70
YLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDV     71 - 140
ACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTM    141 - 210
KNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDK    211 - 280
ELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKV    281 - 350
KKAKNKKLGALTAEEIALKMEADEKKKKKKK                                           351 - 381
//

Text Mined References (30)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19590578 2009 DAI/ZBP1 recruits RIP1 and RIP3 through RIP homotypic interaction motifs to activate NF-kappaB.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15590835 2004 The small-subunit processome is a ribosome assembly intermediate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11359931 2001 Dribble, the Drosophila KRR1p homologue, is involved in rRNA processing.
11027267 2000 Yeast Krr1p physically and functionally interacts with a novel essential Kri1p, and both proteins are required for 40S ribosome biogenesis in the nucleolus.
8675026 1996 A novel cross-phylum family of proteins comprises a KRR1 (YCL059c) gene which is essential for viability of Saccharomyces cerevisiae cells.
7724608 1995 The glucocorticoid receptor type II complex is a target of the HIV-1 vpr gene product.
7505766 1994 Expression of (cac)n/(gtg)n simple repetitive sequences in mRNA of human lymphocytes.