Property Summary

NCBI Gene PubMed Count 177
PubMed Score 38.81
PubTator Score 46.64

Knowledge Summary


No data available


  Differential Expression (16)

Disease log2 FC p
astrocytoma 2.000 1.6e-03
atypical teratoid/rhabdoid tumor 1.300 4.6e-08
dermatomyositis 1.200 9.6e-04
glioblastoma 1.400 2.4e-02
group 3 medulloblastoma 1.300 6.9e-04
lung adenocarcinoma 1.198 2.6e-06
lung cancer 1.300 4.5e-04
medulloblastoma, large-cell 1.100 9.3e-05
osteosarcoma -1.529 1.1e-04
ovarian cancer -1.100 4.9e-04
pancreatic ductal adenocarcinoma liver m... 1.211 2.8e-02
pediatric high grade glioma 1.100 7.1e-06
Pick disease 1.100 4.1e-06
psoriasis -3.800 5.2e-06
subependymal giant cell astrocytoma 1.148 2.5e-02
Waldenstrons macroglobulinemia 1.077 4.4e-03

Protein-protein Interaction (1)

Gene RIF (103)

AA Sequence

PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA                                      841 - 876

Text Mined References (197)

PMID Year Title