Property Summary

NCBI Gene PubMed Count 65
PubMed Score 16.51
PubTator Score 23.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Pit and fissure caries 2
Disease Target Count Z-score Confidence
Rabies 19 3.297 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.300 3.3e-02
psoriasis -1.100 2.3e-04
osteosarcoma -1.194 2.2e-05
primary pancreatic ductal adenocarcinoma 1.484 6.6e-04
inflammatory breast cancer 1.100 1.1e-03
spina bifida -1.269 2.7e-02
ovarian cancer 1.500 9.5e-05
pancreatic cancer 1.100 4.4e-03

Gene RIF (59)

PMID Text
26283154 Our results showed that miR-181 family expression was closely correlated with TCGA subtypes and patients' overall survival, indicating that miR-181b.
26245896 Karyopherin alpha 3 and karyopherin alpha 4 proteins mediate the nuclear import of methyl-CpG binding protein 2.
24284509 miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy
23861882 upon DNA damage transport adaptor importin-alpha4 imports XPA into the nucleus in an ATR-dependent manner.
23383277 Importin alpha3/Qip1 is involved in multiplication of mutant influenza virus with alanine mutation at amino acid 9 independently of nuclear transport function.
22928108 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22509482 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22174317 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
22110766 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
21763491 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
21326825 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
20554775 Impalpha3 is an HIV integrase-interacting cofactor and is required for efficient HIV-1 nuclear import and replication.
20554775 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
20193720 The papillomavirus E2 proteins preferentially interacted with alpha importins 3 and 5, and showed very weak or no interaction with the other three widely expressed alpha importins (alpha1, alpha 4, and alpha 7).
20015032 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
19961612 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
19927155 stress-induced accumulation of non-ubiquitinated p53 in the cytoplasm promotes interaction with importin-alpha3 and rapid import
19710421 Expression of importin alpha3, a protein involved in p50/p65 nuclear import, was decreased in cells overexpressing PHB.
17661348 Daxx interacts selectively with importin alpha3 through its NLS1 and NLS2 sequences. Conversely, importin alpha3 utilizes two NLS-binding sites for Daxx interaction, suggesting that it mediates nuclear import of Daxx.
17411366 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
16375861 Our results indicate that the nuclear import of RHA is mediated by the importin-alpha3/importin-beta-dependent pathway and suggest that the specificity for importin may regulate the functions of cargo proteins.
15037073 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
12414950 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
12368302 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
11904219 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
11389849 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
11278458 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
11035935 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
10964507 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
10888652 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
10860744 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
10525473 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
10366569 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9918876 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9603322 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9593140 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9562972 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9557700 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9548947 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9463369 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9366553 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9303297 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9282826 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9275210 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
9008157 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8876228 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8659115 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8552640 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8551560 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8529100 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8105392 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8041786 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
8041734 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
7859280 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
7745752 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
7585960 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
7494303 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
2064827 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN
1631159 HIV-1 Integrase (IN) double mutant KK215/219AA and RK263/264AA severely impairs its binding to importin 3 alpha. W179A/N183A and W348A/N352A mutations in the major and the minor NLS binding grooves of Imp alpha3 significantly reduce its binding to IN

AA Sequence

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQN      1 - 70
TSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALT     71 - 140
NIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP    141 - 210
SIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMV    211 - 280
IDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL    281 - 350
SNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL    351 - 420
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDI    421 - 490
DEDPSLVPEAIQGGTFGFNSSANVPTEGFQF                                           491 - 521
//

Text Mined References (75)

PMID Year Title
26283154 2015 Upregulation of miR-181s reverses mesenchymal transition by targeting KPNA4 in glioblastoma.
26245896 2015 Karyopherin ? 3 and karyopherin ? 4 proteins mediate the nuclear import of methyl-CpG binding protein 2.
25416956 2014 A proteome-scale map of the human interactome network.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24284509 2014 MiR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin ?4 and ?5 in IgA nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864635 2013 Dissection of the C-terminal region of E1A redefines the roles of CtBP and other cellular targets in oncogenic transformation.
23861882 2013 UV-induced nuclear import of XPA is mediated by importin-?4 in an ATR-dependent manner.
23383277 2013 Importin ?3/Qip1 is involved in multiplication of mutant influenza virus with alanine mutation at amino acid 9 independently of nuclear transport function.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21454664 2011 Importin alpha protein acts as a negative regulator for Snail protein nuclear import.
21269460 2011 Initial characterization of the human central proteome.
20554775 2010 Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication.
20193720 2010 Common importin alpha specificity for papillomavirus E2 proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19927155 2010 Stress-mediated nuclear stabilization of p53 is regulated by ubiquitination and importin-alpha3 binding.
19710421 2009 Prohibitin inhibits tumor necrosis factor alpha-induced nuclear factor-kappa B nuclear translocation via the novel mechanism of decreasing importin alpha3 expression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17981117 2007 Plasmodium circumsporozoite protein promotes the development of the liver stages of the parasite.
17661348 2008 Daxx contains two nuclear localization signals and interacts with importin alpha3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16375861 2006 The nuclear import of RNA helicase A is mediated by importin-alpha3.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12610148 2003 A nonconventional nuclear localization signal within the UL84 protein of human cytomegalovirus mediates nuclear import via the importin alpha/beta pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414950 2002 Reassessment of the roles of integrase and the central DNA flap in human immunodeficiency virus type 1 nuclear import.
12368302 2002 Nuclear localization of human immunodeficiency virus type 1 preintegration complexes (PICs): V165A and R166A are pleiotropic integrase mutants primarily defective for integration, not PIC nuclear import.
11904219 2002 Inhibition of nuclear import by backbone cyclic peptidomimetics derived from the HIV-1 MA NLS sequence.
11389849 2001 HIV-1 infection requires a functional integrase NLS.
11278458 2001 Characterization of the nuclear import pathway for HIV-1 integrase.
11035935 2000 Cellular distribution and karyophilic properties of matrix, integrase, and Vpr proteins from the human and simian immunodeficiency viruses.
10965137 2000 Assignment of KPNA4 and KPNB1 encoding karyopherin alpha 4 and beta 1 to human chromosome bands 11q22 and 17q21 respectively, by in situ hybridization.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10888652 2000 The karyophilic properties of human immunodeficiency virus type 1 integrase are not required for nuclear import of proviral DNA.
10860744 2000 Two nuclear localization signals in the HIV-1 matrix protein regulate nuclear import of the HIV-1 pre-integration complex.
10525473 1999 HIV-1 nuclear import: in search of a leader.
10366569 1999 Nuclear localization of human immunodeficiency virus type 1 integrase expressed as a fusion protein with green fluorescent protein.
10100610 1999 Interaction of tissue transglutaminase with nuclear transport protein importin-alpha3.
9918876 1999 Phenotype of HIV-1 lacking a functional nuclear localization signal in matrix protein of gag and Vpr is comparable to wild-type HIV-1 in primary macrophages.
9603322 1998 A role for human immunodeficiency virus type 1 Vpr during infection of peripheral blood mononuclear cells.
9593140 1998 CNI-H0294, a nuclear importation inhibitor of the human immunodeficiency virus type 1 genome, abrogates virus replication in infected activated peripheral blood mononuclear cells.
9562972 1998 HIV-1 nuclear import: matrix protein is back on center stage, this time together with Vpr.
9557700 1998 The putative alpha helix 2 of human immunodeficiency virus type 1 Vpr contains a determinant which is responsible for the nuclear translocation of proviral DNA in growth-arrested cells.
9548947 1998 Backbone cyclic peptide, which mimics the nuclear localization signal of human immunodeficiency virus type 1 matrix protein, inhibits nuclear import and virus production in nondividing cells.
9463369 1998 Viral protein R regulates nuclear import of the HIV-1 pre-integration complex.
9395085 1997 Cloning of two novel human importin-alpha subunits and analysis of the expression pattern of the importin-alpha protein family.
9366553 1997 HIV-1 nuclear import: in search of a leader.
9303297 1997 HIV-1 infection of non-dividing cells: evidence that the amino-terminal basic region of the viral matrix protein is important for Gag processing but not for post-entry nuclear import.
9282826 1997 HIV-1 p17 and IFN-gamma both induce fructose 1,6-bisphosphatase.
9275210 1997 HIV-1 infection of nondividing cells through the recognition of integrase by the importin/karyopherin pathway.
9168958 1997 Cloning of a cDNA encoding a novel importin-alpha homologue, Qip1: discrimination of Qip1 and Rch1 from hSrp1 by their ability to interact with DNA helicase Q1/RecQL.
9110174 1997 Large-scale concatenation cDNA sequencing.
9008157 1997 Phosphorylation of residue 131 of HIV-1 matrix is not required for macrophage infection.
8876228 1996 Critical role of reverse transcriptase in the inhibitory mechanism of CNI-H0294 on HIV-1 nuclear translocation.
8659115 1996 Evidence for direct association of Vpr and matrix protein p17 within the HIV-1 virion.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8552640 1996 Phosphorylation-dependent human immunodeficiency virus type 1 infection and nuclear targeting of viral DNA.
8551560 1996 Role of the karyopherin pathway in human immunodeficiency virus type 1 nuclear import.
8529100 1995 Nuclear localization signal of HIV-1 as a novel target for therapeutic intervention.
8105392 1993 A nuclear localization signal within HIV-1 matrix protein that governs infection of non-dividing cells.
8041786 1994 The Vpr protein of human immunodeficiency virus type 1 influences nuclear localization of viral nucleic acids in nondividing host cells.
8041734 1994 The nuclear localization signal of the matrix protein of human immunodeficiency virus type 1 allows the establishment of infection in macrophages and quiescent T lymphocytes.
7859280 1995 HIV-1 infection of nondividing cells: C-terminal tyrosine phosphorylation of the viral matrix protein is a key regulator.
7745752 1995 Role of the basic domain of human immunodeficiency virus type 1 matrix in macrophage infection.
7585960 1995 HIV nuclear import is governed by the phosphotyrosine-mediated binding of matrix to the core domain of integrase.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
2064827 1991 p17 and p17-containing gag precursors of input human immunodeficiency virus are transported into the nuclei of infected cells.
1631159 1992 Active nuclear import of human immunodeficiency virus type 1 preintegration complexes.