Property Summary

NCBI Gene PubMed Count 189
PubMed Score 86.17
PubTator Score 136.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 4.0e-262
non-small cell lung carcinoma 413 6.3e-19
lung adenocarcinoma 2714 7.8e-11
acute myeloid leukemia 785 3.9e-02
Disease Target Count Z-score Confidence
Nijmegen breakage syndrome 23 3.608 1.8
Cancer 2346 3.389 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.300 7.8e-11
non-small cell lung carcinoma 1.300 6.3e-19
acute myeloid leukemia 1.100 3.9e-02
psoriasis 1.800 4.0e-262

Protein-protein Interaction (9)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
435026 confirmatory 407 / 3 / 606 Fluorescence Cell-Free Homogeneous Counterscreen to Identify Inhibitors of the RanGTP-Importin-beta complex.
493094 confirmatory 13 / 0 / 27 Conterscreen for target specificity Measured in Cell-Free Homogeneous System Using Plate Reader - 2041-02_Inhibitor_Dose_DryPowder_Activity

Gene RIF (149)

PMID Text
26884852 The combination of low nuclear and cytoplasmic KPNA2 expression is associated with adverse outcome in head and neck squamous cell carcinoma treated with radio(chemo)therapy.
26663089 High KPNA2 expression was found to be associated with poor prognosis and resistance to hyperthermochemoradiation therapy (HCRT).
26626145 KPNA2 might play an important role in colorectal carcinogenesis and functions as a novel prognostic indicator and a potential therapeutic target for colorectal cancer.
26553592 provided support for a link between autophagy and epithelial-to-mesenchymal (-like) transition status in WT TP53 glioblastoma cells and provided evidence for the signaling pathway (MIR517C-KPNA2-cytoplasmic TP53) involved in attenuating autophagy
26491019 RBBP4 functions as a novel regulatory factor to increase the efficiency of importin alpha/beta-mediated nuclear import
26209501 High KPNA2 expression is associated with osteoarthritis.
26135850 Suggest that KPNA2 may play a key role in the inflammation process of rheumatoid arthritis via NF-kappaB P65 signal transduction pathway.
25989275 This study provides further evidence for the complexity of DDR mechanism in BC, and that KNPA2 has a role in the aberrant subcellular localisation of DDR proteins with subsequent impaired function.
25956057 High KPNA2 immunoreactivity is a predictor of bladder recurrence and poor survival in patients with upper tract urothelial carcinoma treated with radical nephroureterectomy.
25862856 OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC
25728791 A novel role of karyopherin alpha 2 in cell migration through the regulation of vimentin-pErk protein complex levels in lung cancer.
25658636 Crystal structure of human importin-alpha1 (Rch1), revealing a potential autoinhibition mode involving homodimerization.
25109899 KPNA2 was overexpressed in esophageal squamous cell carcinoma tissue and cell lines. Serum KPNA2 was higher in ESCC patients than in controls. KPNA2 knockdown inhibited cell proliferation and colony formation ability and induced a G2/M phase arrest.
25060425 The nuclear import of PLAG1 by KPNA2 is essential for the role of KPNA2 in HCC cells.
25031071 Aberrant expression of nuclear KPNA2 is correlated with early recurrence and poor prognosis in patients with small hepatocellular carcinoma after hepatectomy.
24930886 a significant correlation of KPNA2 expression and tumour aggressiveness in a large variety of other solid tumour entities
24814927 These findings demonstrate that rotavirus probably employs a novel strategy to inhibit interferon-induced STAT signalling, which acts after STAT1/STAT2 activation and binding to importin-alpha.
24799281 KPNA2 and CDK1 expression levels may discriminate between estrogen receptor positive patients of high and low risk of disease recurrence.
24799195 The cellular apoptosis susceptibility/importin-alpha1 transport cycle is linked to X-linked inhibitor (XIAP) and is required to maintain tumor cell survival in hepatocellular carcinoma.
24744753 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
24712655 This work extends published observations on SAMHD1 nuclear localization to a natural cell type for HIV-1 infection and identifies KPNA2/KPNB1 as cellular proteins important for SAMHD1 nuclear import.
24664371 study analyzed nuclear expression of karyopherin a2 in meningiomas; expression correlated with histological grade and proliferative activity; recurrent tumors expressed significantly higher levels of karyopherin a2 when compared to primary growths
24510842 High NBS1 expression was linked to biochemical recurrence in ERG-negative and PTEN non-deleted cancers, which was largely driven by high KPNA2 karyopherin alpha 2 expression.
24103892 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
24098495 Karyopherin alpha2 is essential for rRNA transcription and protein synthesis in proliferative keratinocytes.
24070213 Oct4 and KPNA2 play an important role in non-small-cell lung cancer progression.
24067372 SEPT9 isoform 1 is required for the association between HIF-1alpha and importin-alpha to promote efficient nuclear translocation.
23907459 KPNA2 has an important role in promoting proliferation and tumorigenicity of epithelial ovarian carcinoma through upregulation of c-myc and suppression of FOXO3A.
23887301 Identified a strong link between high KPNA2 expression and early PSA recurrence in prostate cancer patients treated with radical prostatectomy.
23749771 Nuclear karyopherin-alpha2 expression in primary lesions and metastatic lymph nodes was associated with poor prognosis and progression in gastric cancer.
23649804 Tpr import is mediated by the most abundant import receptor, KPNA2, which binds the bipartite NLS in Tpr with nanomolar affinity
23536776 This work defines an inflammatory signature shared by seven epithelial cancer types and KPNA2 as a consistently up-regulated protein in cancer.
23435424 IGFBP-2 possesses a functional nuclear localization signal sequence and IGFBP-2 actively translocates into the nucleus by a classical nuclear import mechanism, involving formation of IGFBP-2 complexes with importin-alpha.
23283818 Overexpression of KPNA2 correlates with gastric adenocarcinoma.
22962582 Overexpression of karyopherin 2 (KPNA2) in human ovarian malignant germ cell tumor correlates with poor prognosis.
22928108 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
22843992 The KPNA2-regulating protein profiles in an adenocarcinoma cell line, were analyzed.
22772608 KPNA2 expression may have potential as a novel diagnostic and prognostic biomarker for astrocytic gliomas.
22509482 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
22417684 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
22415091 Nuclear translocation of Wilms' tumour protein involves importins alpha and beta, and a nuclear localisation signal in the third zinc finger
22275867 Importin alpha1 and alpha7 are positive regulators of human-like polymerase activity and pathogenicity beyond their role in nuclear transport.
22174317 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
22125623 findings suggest that the deregulated activity of E2F in cancer cells causes increased activation of the Kpnbeta1 and Kpnalpha2 promoters, leading to elevated levels of these proteins, and ultimately impacting the cancer phenotype.
22110766 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
21909132 This study gives clear evidence that KPNA2 acts as a novel oncogenic factor in human breast cancer, in vitro.
21690087 Crystallographic analysis of mammalian importin alpha1 in complex with the hPLSCR4-NLS reveals this minimal NLS binds specifically and exclusively to the minor binding site of importin alpha
21489275 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
21454664 importin alpha interacted with the zinc finger domain of Snail to compete with the binding of importin beta1 and Snail did not form a ternary complex with importin alpha/importin beta1.
21418451 Taspase1 appears to exploit the nuclear export activity of importin-alpha/nucleophosmin to gain transient access to the cytoplasm required to also cleave its cytoplasmic substrates.
21330047 KPNA2 expression is a marker for progression of non-muscle-invasive bladder cancer and a prognostic marker in patients undergoing radical cystectomy.
21326825 Transportin 3 and importin alpha act as receptors and are required for effective nuclear import of HIV-1 integrase in virus-infected cells.
21326825 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
21321119 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
21318276 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
21286940 Overexpression of importin alpha1 is associated with hepatocellular carcinoma.
21220479 KPNA2 expression was significantly upregulated in carcinomas of the prostate, especially in metastatic and castration-resistant prostate cancer samples; it is a novel independent prognostic marker for disease progression after radical prostatectomy
20859152 Overexpression of KPNA2 in patients with epithelial ovarian cancer is positively associated with an epithelial ovarian cancer-specific histologic type and a poor prognosis.
20719241 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
20658535 protein levels of KPNA2 in pleural effusion from NSCLC patients were also significantly higher than those from non-lung cancer. Moreover, knockdown of KPNA2 inhibited the migration ability and viability of lung cancer cells
20393006 KPNA2 expression is associated with poor differentiation, tumor invasiveness, and tumor proliferation in esophageal squamous cell carcinoma.
20362631 Data reveal the involvement of importin alpha1 in the assembly of RNA granules and its pro-survival role during stress
20015032 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19961612 nuclear import of HIV-1 integrase(IN) occurs via importin alpha pathway and promoted by a specific nuclear localization signal(NLS).Import could be blocked by NLS-IN peptide confirming that nuclear import of viral preintegration complex is mediated by IN.
19961612 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19883659 The tripartite protein-RNA complex formation between Hexim, Cyclin T and 7SK snRNA, was analyzed.
19803398 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19458171 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19454010 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19338763 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19275582 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
19117056 Crm1, Kpnbeta1 and Kpnalpha2 are overexpressed in cervical cancer and inhibiting the expression of Crm1 and Kpnbeta1, not Kpnalpha2, induces cancer cell death
19103427 Oct4 nuclear localization may be mediated by its interaction with KPNA-2.
18561322 KPNA2 nuclear expression as novel prognostic marker in node-positive breast cancer patients
18068677 The formation of high molecular mass complexes containing importin-alpha, Nup153 and Nup88 is increased upon oxidant treatment.
17899179 Expression of KPNA2 in invasive breast cancer correlates with conventional prognostic parameters & shorter disease-free survival. KPNA2 is overexpressed in DCIS, which emphasizes its potential role in carcinogenesis of invasive breast carcinomas.
17596301 SARS-COV ORF6 protein is localized to the endoplasmic reticulum (ER)/Golgi membrane in infected cells, where it binds to and disrupts nuclear import complex formation by tethering karyopherin alpha 2 and karyopherin beta 1 to the membrane.
17586317 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
17551513 The data, together with previous analyses of nuclear protein import, suggest that the use of adapters such as importin-alpha provides the cell with increased dynamic range for control of nuclear import rates, but at the expense of efficiency.
17537211 dengue virus nonstructural protein 5 nuclear localization through its importin alpha/beta-recognized nuclear localization sequences is integral to viral infection
17411366 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
17360709 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
17344301 interaction between importin alpha and the N-terminal alpha-helical domain of Vpr is indispensable, not only for the nuclear import of Vpr but also for HIV-1 replication in macrophages.
17344301 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
17255955 KPNA2 may play an important role in the signal-transduction pathways that regulate epidermal proliferation and differentiation
17070506 importin alpha1, an essential component of cytoplasmic-nuclear transport, is abnormally accumulated in Hirano bodies in vulnerable hippocampal neurons in AD.
16818692 The gene expression profiling of laser-microdissected breast cancer tissue revealed KPNA2 genes that may represent potential molecular targets for breast cancer therapy and prediction of outcome.
16752129 This review focuses on recent experimental evidences demonstrating how NBS1 is translocated into the nucleus by an importin KPNA2 which mediates NBS1 subcellular localization and the functions of the NBS1 complex in tumorigenesis.
16552725 These data suggest the importance of receptor endocytosis, endosomal sorting machinery, interaction with importins alpha1/beta1, and exportin CRM1 in EGFR nuclear-cytoplasmic trafficking.
16188882 an interaction with KPNA2 contributes to nuclear localization and multiple tumor suppression functions of the NBS1 complex
15795315 The model reflects experimentally determined rates for cargo import and correctly predicts that import is limited principally by Impalpha and Ran, but is also sensitive to NTF2
15731250 These observations indicate that importin-alpha functions as a mediator for the nuclear entry of Vpr.
15731250 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
15342649 Results point to importin alpha1 as a critical downstream target of AMP-activated protein kinase (AMPK) and key mediator of AMPK-triggered HuR nuclear import.
15234975 interaction with importin system is required for thioredoxin-binding protein-2 nuclear translocation and growth control tightly associated with TRX-dependent redox regulation of transcription factors
15194443 Importin alpha/beta-mediated nuclear import machinery is regulated in a cell cycle-dependent manner through the modulation of interaction modes between importins alpha and beta.
15142377 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
15037073 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
12909615 confirmed the role of KPNA-2 in nuclear import of Chk2
12883947 IPOA1 was localized at the lymphocyte plasma membrane. Its subcellular distribution was also studied.
12551970 HPV16 E6 interacts with the karyopherin alpha2 adapter and can enter the nucleus of hela cells via a classical Kap alpha2beta1-mediated pathway
12504543 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
12414950 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
12368302 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
11904219 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
11882654 Identification of a karyopherin alpha 2 recognition site in PLAG1, which functions as a nuclear localization signal
11796712 Characterization of an unusual importin alpha binding motif in the borna disease virus p10 protein that directs nuclear import
11389849 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
11278458 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
11152524 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
11035935 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10964507 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10888660 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10888652 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10860744 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10772949 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10525473 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
10366569 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9918876 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9817747 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9603322 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9593140 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9582382 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9562972 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9557700 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9548947 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9463369 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9436978 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9366553 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9303297 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9282826 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9275210 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9261351 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
9008157 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8876228 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8659115 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8552640 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8551560 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8529100 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8105392 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8041786 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
8041734 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
7859280 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
7745752 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
7585960 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
7494303 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
2064827 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways
1631159 Karyopherin alpha and beta are reported to interact with HIV-1 integrase (IN) to facilitate nuclear import of IN, however a conflicting report indicates nuclear accumulation of IN does not involve karyopherin alpha, beta 1, or beta 2 mediated pathways

AA Sequence

MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNN      1 - 70
QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES     71 - 140
AWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLL    141 - 210
ALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTD    211 - 280
GPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN    281 - 350
IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG    351 - 420
IIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLS    421 - 490
LIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF                                   491 - 529
//

Text Mined References (201)

PMID Year Title
26884852 2015 Low cytoplasmic and nuclear KPNA2 expression in radiotherapy-treated head and neck squamous cell cancer is associated with an adverse outcome.
26663089 2016 KPNA2 over-expression is a potential marker of prognosis and therapeutic sensitivity in colorectal cancer patients.
26626145 2015 Karyopherin alpha 2 is a novel prognostic marker and a potential therapeutic target for colon cancer.
26553592 2015 MIR517C inhibits autophagy and the epithelial-to-mesenchymal (-like) transition phenotype in human glioblastoma through KPNA2-dependent disruption of TP53 nuclear translocation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491019 2015 Retinoblastoma-binding Protein 4-regulated Classical Nuclear Transport Is Involved in Cellular Senescence.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26209501 2015 KPNA2 interacts with P65 to modulate catabolic events in osteoarthritis.
26135850 2015 KPNA2 Contributes to the Inflammatory Processes in Synovial Tissue of Patients with Rheumatoid Arthritis and SW982 Cells.
25989275 2015 KPNA2 is a nuclear export protein that contributes to aberrant localisation of key proteins and poor prognosis of breast cancer.
25956057 2015 High expression of KPNA2 defines poor prognosis in patients with upper tract urothelial carcinoma treated with radical nephroureterectomy.
25862856 2015 Gene expression analysis for evaluation of potential biomarkers in hepatocellular carcinoma.
25728791 2015 Quantitative proteomics reveals a novel role of karyopherin alpha 2 in cell migration through the regulation of vimentin-pErk protein complex levels in lung cancer.
25658636 2015 Crystal structure of human importin-?1 (Rch1), revealing a potential autoinhibition mode involving homodimerization.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25109899 2014 KPNA2 is a promising biomarker candidate for esophageal squamous cell carcinoma and correlates with cell proliferation.
25060425 2014 Pleomorphic adenoma gene 1 mediates the role of karyopherin alpha 2 and has prognostic significance in hepatocellular carcinoma.
25031071 2014 Aberrant expression of nuclear KPNA2 is correlated with early recurrence and poor prognosis in patients with small hepatocellular carcinoma after hepatectomy.
24930886 2014 KPNA2 is overexpressed in human and mouse endometrial cancers and promotes cellular proliferation.
24814927 2014 Rotavirus inhibits IFN-induced STAT nuclear translocation by a mechanism that acts after STAT binding to importin-?.
24799281 2014 Integrating meta-analysis of microarray data and targeted proteomics for biomarker identification: application in breast cancer.
24799195 2014 Prosurvival function of the cellular apoptosis susceptibility/importin-?1 transport cycle is repressed by p53 in liver cancer.
24712655 2014 Nuclear import of SAMHD1 is mediated by a classical karyopherin ?/?1 dependent pathway and confers sensitivity to VpxMAC induced ubiquitination and proteasomal degradation.
24664371 2014 Karyopherin a2 and chromosome region maintenance protein 1 expression in meningiomas: novel biomarkers for recurrence and malignant progression.
24510842 2014 The prognostic impact of high Nijmegen breakage syndrome (NBS1) gene expression in ERG-negative prostate cancers lacking PTEN deletion is driven by KPNA2 expression.
24098495 2013 Karyopherin alpha2 is essential for rRNA transcription and protein synthesis in proliferative keratinocytes.
24070213 2013 Downregulation of KPNA2 in non-small-cell lung cancer is associated with Oct4 expression.
24067372 2013 SEPT9_i1 is required for the association between HIF-1? and importin-? to promote efficient nuclear translocation.
23907459 2013 KPNA2 promotes cell proliferation and tumorigenicity in epithelial ovarian carcinoma through upregulation of c-Myc and downregulation of FOXO3a.
23887301 2014 High nuclear karyopherin ? 2 expression is a strong and independent predictor of biochemical recurrence in prostate cancer patients treated by radical prostatectomy.
23749771 2013 Nuclear karyopherin-?2 expression in primary lesions and metastatic lymph nodes was associated with poor prognosis and progression in gastric cancer.
23649804 2013 Defective nuclear import of Tpr in Progeria reflects the Ran sensitivity of large cargo transport.
23536776 2013 Molecular profiling of multiple human cancers defines an inflammatory cancer-associated molecular pattern and uncovers KPNA2 as a uniform poor prognostic cancer marker.
23435424 2014 IGFBP-2 nuclear translocation is mediated by a functional NLS sequence and is essential for its pro-tumorigenic actions in cancer cells.
23283818 2013 Overexpression of KPNA2 correlates with poor prognosis in patients with gastric adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22962582 2012 Overexpression of karyopherin 2 in human ovarian malignant germ cell tumor correlates with poor prognosis.
22843992 2012 Quantitative proteomics reveals regulation of karyopherin subunit alpha-2 (KPNA2) and its potential novel cargo proteins in nonsmall cell lung cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22772608 2012 Nuclear karyopherin a2: a novel biomarker for infiltrative astrocytomas.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22415091 2012 Nuclear transport of Wilms' tumour protein Wt1 involves importins ? and ?.
22275867 2012 Human-like PB2 627K influenza virus polymerase activity is regulated by importin-?1 and -?7.
22125623 2011 Overexpression of Kpn?1 and Kpn?2 importin proteins in cancer derives from deregulated E2F activity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21909132 2012 Nuclear transport receptor karyopherin-?2 promotes malignant breast cancer phenotypes in vitro.
21699900 2011 Facioscapulohumeral muscular dystrophy region gene 1 is a dynamic RNA-associated and actin-bundling protein.
21690087 2011 A minimal nuclear localization signal (NLS) in human phospholipid scramblase 4 that binds only the minor NLS-binding site of importin alpha1.
21454664 2011 Importin alpha protein acts as a negative regulator for Snail protein nuclear import.
21418451 2011 The importin-alpha/nucleophosmin switch controls taspase1 protease function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385873 2011 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31.
21330047 2011 High expression of karyopherin-?2 defines poor prognosis in non-muscle-invasive bladder cancer and in patients with invasive bladder cancer undergoing radical cystectomy.
21326825 Transportin 3 and importin ? are required for effective nuclear import of HIV-1 integrase in virus-infected cells.
21286940 2011 Importin-?1 as a novel prognostic target for hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21220479 2011 KPNA2 expression is an independent adverse predictor of biochemical recurrence after radical prostatectomy.
20965181 2010 Regulation of nuclear localization signal-importin ? interaction by Ca2+/S100A6.
20859152 2010 Overexpression of karyopherin-2 in epithelial ovarian cancer and correlation with poor prognosis.
20658535 2011 Importin subunit alpha-2 is identified as a potential biomarker for non-small cell lung cancer by integration of the cancer cell secretome and tissue transcriptome.
20551905 2010 A classical NLS and the SUN domain contribute to the targeting of SUN2 to the inner nuclear membrane.
20393006 2010 Significance of karyopherin-{alpha} 2 (KPNA2) expression in esophageal squamous cell carcinoma.
20362631 2010 Identification of importin alpha1 as a novel constituent of RNA stress granules.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19961612 2009 Inhibition of HIV-1 integrase nuclear import and replication by a peptide bearing integrase putative nuclear localization signal.
19950226 2010 Single nucleotide polymorphisms in miRNA binding sites and miRNA genes as breast/ovarian cancer risk modifiers in Jewish high-risk women.
19946888 2010 Defining the membrane proteome of NK cells.
19883659 2010 Specificity of Hexim1 and Hexim2 complex formation with cyclin T1/T2, importin alpha and 7SK snRNA.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386897 2009 Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors.
19117056 2009 The Karyopherin proteins, Crm1 and Karyopherin beta1, are overexpressed in cervical cancer and are critical for cancer cell survival and proliferation.
19103427 2008 Identification of karyopherin-alpha 2 as an Oct4 associated protein.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18561322 2008 Nuclear karyopherin alpha2 expression predicts poor survival in patients with advanced breast cancer irrespective of treatment intensity.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18068677 2008 Oxidative stress mislocalizes and retains transport factor importin-alpha and nucleoporins Nup153 and Nup88 in nuclei where they generate high molecular mass complexes.
17899179 2007 KPNA2 protein expression in invasive breast carcinoma and matched peritumoral ductal carcinoma in situ.
17596301 2007 Severe acute respiratory syndrome coronavirus ORF6 antagonizes STAT1 function by sequestering nuclear import factors on the rough endoplasmic reticulum/Golgi membrane.
17551513 2007 The adapter importin-alpha provides flexible control of nuclear import at the expense of efficiency.
17537211 2007 Nuclear localization of dengue virus nonstructural protein 5 through its importin alpha/beta-recognized nuclear localization sequences is integral to viral infection.
17344301 2007 Novel nuclear import of Vpr promoted by importin alpha is crucial for human immunodeficiency virus type 1 replication in macrophages.
17324944 2007 The second AT-hook of the architectural transcription factor HMGA2 is determinant for nuclear localization and function.
17255955 2007 Differential regulation of karyopherin alpha 2 expression by TGF-beta1 and IFN-gamma in normal human epidermal keratinocytes: evident contribution of KPNA2 for nuclear translocation of IRF-1.
17170104 2007 Classical nuclear localization signals: definition, function, and interaction with importin alpha.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17070506 2006 Aberrant localization of importin alpha1 in hippocampal neurons in Alzheimer disease.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16818692 2006 Molecular profiling of laser-microdissected matched tumor and normal breast tissue identifies karyopherin alpha2 as a potential novel prognostic marker in breast cancer.
16752129 2006 Importin KPNA2, NBS1, DNA repair and tumorigenesis.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16552725 2006 Nuclear-cytoplasmic transport of EGFR involves receptor endocytosis, importin beta1 and CRM1.
16380377 2006 The nuclear import of protein kinase D3 requires its catalytic activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16188882 2005 Importin KPNA2 is required for proper nuclear localization and multiple functions of NBS1.
15942031 2005 Analysis of nuclear transport signals in the human apurinic/apyrimidinic endonuclease (APE1/Ref1).
15870280 2005 The nuclear import of TAF10 is regulated by one of its three histone fold domain-containing interaction partners.
15795315 2005 A systems analysis of importin-{alpha}-{beta} mediated nuclear protein import.
15731250 2005 Importin-alpha promotes passage through the nuclear pore complex of human immunodeficiency virus type 1 Vpr.
15635413 2005 Nucleolar proteome dynamics.
15507604 2004 The l2 minor capsid protein of human papillomavirus type 16 interacts with a network of nuclear import receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15342649 2004 AMP-activated protein kinase-regulated phosphorylation and acetylation of importin alpha1: involvement in the nuclear import of RNA-binding protein HuR.
15234975 2004 Importin alpha1 (Rch1) mediates nuclear translocation of thioredoxin-binding protein-2/vitamin D(3)-up-regulated protein 1.
15194443 2004 Importin alpha/beta-mediated nuclear protein import is regulated in a cell cycle-dependent manner.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
12933681 2003 Yellow fluorescent protein-tagged and cyan fluorescent protein-tagged imaging analysis of glucocorticoid receptor and importins in single living cells.
12909615 2003 Karyopherin-alpha2 protein interacts with Chk2 and contributes to its nuclear import.
12883947 2003 Localization of importin alpha (Rch1) at the plasma membrane and subcellular redistribution during lymphocyte activation.
12881431 2003 The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay.
12631736 2003 Importin-alpha mediates the regulated nuclear targeting of serum- and glucocorticoid-inducible protein kinase (Sgk) by recognition of a nuclear localization signal in the kinase central domain.
12551970 2003 Nuclear entry of high-risk human papillomavirus type 16 E6 oncoprotein occurs via several pathways.
12504543 2003 Antibody fragments selected by phage display against the nuclear localization signal of the HIV-1 Vpr protein inhibit nuclear import in permeabilized and intact cultured cells.
12504098 2003 An intracellular targeted NLS peptide inhibitor of karyopherin alpha:NF-kappa B interactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477715 2003 Role of prodomain in importin-mediated nuclear localization and activation of caspase-2.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
12414950 2002 Reassessment of the roles of integrase and the central DNA flap in human immunodeficiency virus type 1 nuclear import.
12368302 2002 Nuclear localization of human immunodeficiency virus type 1 preintegration complexes (PICs): V165A and R166A are pleiotropic integrase mutants primarily defective for integration, not PIC nuclear import.
12186919 2002 Interaction of the Vp3 nuclear localization signal with the importin alpha 2/beta heterodimer directs nuclear entry of infecting simian virus 40.
12176322 2002 Npap60/Nup50 is a tri-stable switch that stimulates importin-alpha:beta-mediated nuclear protein import.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
12011095 2002 EDD, the human hyperplastic discs protein, has a role in progesterone receptor coactivation and potential involvement in DNA damage response.
11988093 2002 Karyopherin alpha2: a control step of glucose-sensitive gene expression in hepatic cells.
11971900 2002 Nuclear import strategies of high risk HPV16 L1 major capsid protein.
11904219 2002 Inhibition of nuclear import by backbone cyclic peptidomimetics derived from the HIV-1 MA NLS sequence.
11882654 2002 Identification of a karyopherin alpha 2 recognition site in PLAG1, which functions as a nuclear localization signal.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11735022 2001 Genomic structure of karyopherin alpha2 ( KPNA2) within a low-copy repeat on chromosome 17q23-q24 and mutation analysis in patients with Russell-Silver syndrome.
11581171 2001 Nuclear localization of the tyrosine kinase Itk and interaction of its SH3 domain with karyopherin alpha (Rch1alpha).
11389849 2001 HIV-1 infection requires a functional integrase NLS.
11310559 2001 Identification of nuclear-import and cell-cycle regulatory proteins that bind to prothymosin alpha.
11278458 2001 Characterization of the nuclear import pathway for HIV-1 integrase.
11152524 2001 Nucleocytoplasmic shuttling by human immunodeficiency virus type 1 Vpr.
11114884 2000 Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha.
11035935 2000 Cellular distribution and karyophilic properties of matrix, integrase, and Vpr proteins from the human and simian immunodeficiency viruses.
10980193 2000 ARL4, an ARF-like protein that is developmentally regulated and localized to nuclei and nucleoli.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10930427 2000 Truncated form of importin alpha identified in breast cancer cell inhibits nuclear import of p53.
10888660 2000 Two putative alpha-helical domains of human immunodeficiency virus type 1 Vpr mediate nuclear localization by at least two mechanisms.
10888652 2000 The karyophilic properties of human immunodeficiency virus type 1 integrase are not required for nuclear import of proviral DNA.
10869435 2000 Regulation of histone deacetylase 4 and 5 and transcriptional activity by 14-3-3-dependent cellular localization.
10860744 2000 Two nuclear localization signals in the HIV-1 matrix protein regulate nuclear import of the HIV-1 pre-integration complex.
10801418 2000 Acetylation of importin-alpha nuclear import factors by CBP/p300.
10772949 2000 Intranuclear binding by the HIV-1 regulatory protein VPR is dependent on cytosolic factors.
10748034 2000 BSAP (Pax5)-importin alpha 1 (Rch1) interaction identifies a nuclear localization sequence.
10525473 1999 HIV-1 nuclear import: in search of a leader.
10497201 1999 Intracellular localization of human cytidine deaminase. Identification of a functional nuclear localization signal.
10366569 1999 Nuclear localization of human immunodeficiency virus type 1 integrase expressed as a fusion protein with green fluorescent protein.
10359596 1999 Deciphering the nuclear import pathway for the cytoskeletal red cell protein 4.1R.
10353244 1999 Structure of importin-beta bound to the IBB domain of importin-alpha.
10228156 1999 The importin beta/importin 7 heterodimer is a functional nuclear import receptor for histone H1.
9918876 1999 Phenotype of HIV-1 lacking a functional nuclear localization signal in matrix protein of gag and Vpr is comparable to wild-type HIV-1 in primary macrophages.
9817747 1998 Characterization of HIV-1 vpr nuclear import: analysis of signals and pathways.
9786944 1998 Determination of the functional domain organization of the importin alpha nuclear import factor.
9603322 1998 A role for human immunodeficiency virus type 1 Vpr during infection of peripheral blood mononuclear cells.
9593140 1998 CNI-H0294, a nuclear importation inhibitor of the human immunodeficiency virus type 1 genome, abrogates virus replication in infected activated peripheral blood mononuclear cells.
9582382 1998 Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.
9562972 1998 HIV-1 nuclear import: matrix protein is back on center stage, this time together with Vpr.
9557700 1998 The putative alpha helix 2 of human immunodeficiency virus type 1 Vpr contains a determinant which is responsible for the nuclear translocation of proviral DNA in growth-arrested cells.
9548947 1998 Backbone cyclic peptide, which mimics the nuclear localization signal of human immunodeficiency virus type 1 matrix protein, inhibits nuclear import and virus production in nondividing cells.
9497340 1998 Identification of a novel cytoplasmic protein that specifically binds to nuclear localization signal motifs.
9463369 1998 Viral protein R regulates nuclear import of the HIV-1 pre-integration complex.
9436978 1998 HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.
9405152 1997 Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta.
9366553 1997 HIV-1 nuclear import: in search of a leader.
9323134 1997 Export of importin alpha from the nucleus is mediated by a specific nuclear transport factor.
9303297 1997 HIV-1 infection of non-dividing cells: evidence that the amino-terminal basic region of the viral matrix protein is important for Gag processing but not for post-entry nuclear import.
9282826 1997 HIV-1 p17 and IFN-gamma both induce fructose 1,6-bisphosphatase.
9275210 1997 HIV-1 infection of nondividing cells through the recognition of integrase by the importin/karyopherin pathway.
9261351 1997 Nuclear import, virion incorporation, and cell cycle arrest/differentiation are mediated by distinct functional domains of human immunodeficiency virus type 1 Vpr.
9168958 1997 Cloning of a cDNA encoding a novel importin-alpha homologue, Qip1: discrimination of Qip1 and Rch1 from hSrp1 by their ability to interact with DNA helicase Q1/RecQL.
9020106 1997 Epstein-Barr virus nuclear antigen 1 forms a complex with the nuclear transporter karyopherin alpha2.
9008157 1997 Phosphorylation of residue 131 of HIV-1 matrix is not required for macrophage infection.
8955125 1996 The nuclear localization sequences of the BRCA1 protein interact with the importin-alpha subunit of the nuclear transport signal receptor.
8876228 1996 Critical role of reverse transcriptase in the inhibitory mechanism of CNI-H0294 on HIV-1 nuclear translocation.
8659115 1996 Evidence for direct association of Vpr and matrix protein p17 within the HIV-1 virion.
8631802 1996 The nuclear localization signal of lymphoid enhancer factor-1 is recognized by two differentially expressed Srp1-nuclear localization sequence receptor proteins.
8617227 1996 The conserved amino-terminal domain of hSRP1 alpha is essential for nuclear protein import.
8617226 1996 A 41 amino acid motif in importin-alpha confers binding to importin-beta and hence transit into the nucleus.
8552640 1996 Phosphorylation-dependent human immunodeficiency virus type 1 infection and nuclear targeting of viral DNA.
8551560 1996 Role of the karyopherin pathway in human immunodeficiency virus type 1 nuclear import.
8529100 1995 Nuclear localization signal of HIV-1 as a novel target for therapeutic intervention.
8105392 1993 A nuclear localization signal within HIV-1 matrix protein that governs infection of non-dividing cells.
8041786 1994 The Vpr protein of human immunodeficiency virus type 1 influences nuclear localization of viral nucleic acids in nondividing host cells.
8041734 1994 The nuclear localization signal of the matrix protein of human immunodeficiency virus type 1 allows the establishment of infection in macrophages and quiescent T lymphocytes.
8016130 1994 Rch1, a protein that specifically interacts with the RAG-1 recombination-activating protein.
7859280 1995 HIV-1 infection of nondividing cells: C-terminal tyrosine phosphorylation of the viral matrix protein is a key regulator.
7754385 1995 Identification of hSRP1 alpha as a functional receptor for nuclear localization sequences.
7745752 1995 Role of the basic domain of human immunodeficiency virus type 1 matrix in macrophage infection.
7604027 1995 Mammalian karyopherin alpha 1 beta and alpha 2 beta heterodimers: alpha 1 or alpha 2 subunit binds nuclear localization signal and beta subunit interacts with peptide repeat-containing nucleoporins.
7585960 1995 HIV nuclear import is governed by the phosphotyrosine-mediated binding of matrix to the core domain of integrase.
7565597 1995 Yeast Srp1, a nuclear protein related to Drosophila and mouse pendulin, is required for normal migration, division, and integrity of nuclei during mitosis.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
2064827 1991 p17 and p17-containing gag precursors of input human immunodeficiency virus are transported into the nuclei of infected cells.
1631159 1992 Active nuclear import of human immunodeficiency virus type 1 preintegration complexes.