Property Summary

NCBI Gene PubMed Count 112
PubMed Score 77.00
PubTator Score 63.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.400 1.2e-06
psoriasis -3.300 7.7e-06
osteosarcoma -2.154 3.2e-09
atypical teratoid / rhabdoid tumor -1.400 1.7e-05
glioblastoma -1.500 5.8e-05
medulloblastoma -1.100 9.7e-04
medulloblastoma, large-cell -1.800 2.6e-06
hereditary spastic paraplegia -1.104 8.2e-03
tuberculosis and treatment for 3 months -1.200 8.9e-05
non-small cell lung cancer 1.526 4.8e-16
lung cancer 1.100 3.2e-02
Breast cancer 2.600 2.5e-02
pediatric high grade glioma -1.100 3.5e-05
Pick disease -1.400 3.4e-05
ovarian cancer 2.100 6.7e-07
dermatomyositis -1.300 5.5e-04

Protein-protein Interaction (3)

Gene RIF (89)

PMID Text
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25272585 Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7.
24744753 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
24284509 miR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin alpha4 and alpha5 in IgA nephropathy
24269683 Results indicate CTNNBL1 as a unique selective nuclear localization signals (NLSs)-binding protein with striking differences from karyopherin-alphas.
23425335 This supports the notion that de novo mutations KPNA1 in are extremely rare in schizophrenia
22509482 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22422068 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22399302 mTOR and protein phosphatase 2A catalytically control the constitutive nuclear import of latent STAT1 by KPNA1, which are key modulators of STAT1 expression and apoptosis.
22321063 LRRC59 facilitates transport of cytosolic FGF1 through nuclear pores by interaction with Kpns and movement of LRRC59 along the ER and NE membranes
22174317 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
22130666 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin alpha5.
22110766 the requirement for and the regulation of CAS in the functioning of the Vpr-Impalpha complex
22110766 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
21987768 The ability of hnRNP C1/C2 to bind KPNA1 is diminished in the presence of VP24, and cells transiently expressing VP24 redistribute hnRNP C1/C2 from the nucleus to the cytoplasm.
21326825 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
21318276 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
21307607 This study reports the identification and classification of importin alpha 5 -interacting proteins in brain cells.
21209321 The mammalian E1 subunits can be imported separately, identify nuclear localization signals (NLSs) in Aos1 and in Uba2, and demonstrate that their import is mediated by importin alpha/beta in vitro and in intact cells.
20974480 Impalpha5 acts as a chaperone until Influenza a virus nucleoprotein (NP) is delivered in the nucleus for viral RNA encapsidation.
20406804 Study identified the sequences KKKRR, KKKRK, and KKRKK as the optimal sequences for binding to this site for mouse importin-alpha2, human importin-alpha1, and human importin-alpha5, respectively.
20193720 The papillomavirus E2 proteins preferentially interacted with alpha importins 3 and 5, and showed very weak or no interaction with the other three widely expressed alpha importins (alpha1, alpha 4, and alpha 7).
20015032 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
19961612 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
19889762 The VP24 IFN antagonist function of ebolavirus requires the ability of VP24 to interact with KPNalpha.
19803398 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
19338763 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
19118899 Karyopherin alpha 1 is a putative substrate of the RAG1 ubiquitin ligase.
19066626 PB2 interaction with alpha-importins is required for virus RNA replication.
19001869 significant KPNA1-, NLRP1- and NLRP3-gene expression phenotypes associated with human genotypes of Crohn's disease, Huntington's disease and rheumatoid arthritis
18707546 NPI-1 subfamily accumulates in the nucleus in response to oxidative stress, like importin alpha1/Rch1.
18238777 importins alpha5 and beta1 associate with Nrf2, an interaction that was blocked by the nuclear import inhibitor SN50
17928350 Here, VP24 is demonstrated to interact with endogenous karyopherin alpha1 and inhibits its interaction with STAT1.
17411366 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
17344301 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
17304248 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
16439554 the karyopherin alpha NPI-1, a nuclear import adaptor, bound more strongly to Epstein-Barr virus nuclear antigen 1 Ser385-phosphorylated nuclear localization signal than to any other phosphorylated or nonphosphorylated forms
16298512 Importin alpha5 and alpha7 bind to Stat3 upon cytokine stimulation.
15731250 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
15142377 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
15037073 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
12740372 one importin alpha molecule is able to use either its N- or C-terminal arm repeats for binding various NLS containing proteins
12504543 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
12414950 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
12368302 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
12048190 arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5
11904219 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
11389849 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
11278458 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
11152524 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
11035935 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10964507 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10888660 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10888652 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10860744 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10772949 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10525473 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
10366569 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9918876 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9817747 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9603322 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9593140 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9582382 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9562972 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9557700 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9548947 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9463369 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9436978 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9366553 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9303297 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9282826 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9275210 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9261351 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
9008157 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8876228 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8659115 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8552640 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8551560 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8529100 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8105392 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8041786 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
8041734 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
7859280 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
7745752 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
7585960 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
7494303 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
2064827 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2
1631159 HIV-1 Vpr interacts with both karyopherin alpha 1 and alpha 2 to facilitate nuclear import of the HIV-1 preintegration complex, however conflicting reports indicate it may also be imported by other mechanisms independently of karyopherin alpha 1 and 2

AA Sequence

MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEA      1 - 70
QISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKEN     71 - 140
CTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDC    141 - 210
NILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSY    211 - 280
LSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSP    281 - 350
KESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV    351 - 420
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQ    421 - 490
EIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL                          491 - 538
//

Text Mined References (119)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272585 2014 [Identification of prototype foamy virus Bel1 nuclear localization signal and its corresponding importins].
24284509 2014 MiR-223 downregulation promotes glomerular endothelial cell activation by upregulating importin ?4 and ?5 in IgA nephropathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269683 2014 Structural and mutational analysis reveals that CTNNBL1 binds NLSs in a manner distinct from that of its closest armadillo-relative, karyopherin ?.
23425335 2013 Investigation of rare variants in LRP1, KPNA1, ALS2CL and ZNF480 genes in schizophrenia patients reflects genetic heterogeneity of the disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22500989 2012 Characterization of nuclear import and export signals determining the subcellular localization of WD repeat-containing protein 42A (WDR42A).
22399302 2012 Regulation of karyopherin ?1 and nuclear import by mammalian target of rapamycin.
22321063 2012 Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpn?1 and Kpn?1.
22130666 2012 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin ?5.
22110766 2011 Nuclear exportin receptor CAS regulates the NPI-1-mediated nuclear import of HIV-1 Vpr.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21987768 2011 The Ebola virus VP24 protein prevents hnRNP C1/C2 binding to karyopherin ?1 and partially alters its nuclear import.
21454664 2011 Importin alpha protein acts as a negative regulator for Snail protein nuclear import.
21385873 2011 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31.
21307607 2011 Proteomic analysis of importin ?-interacting proteins in adult mouse brain.
21269460 2011 Initial characterization of the human central proteome.
21209321 2011 Importin ?/? mediates nuclear import of individual SUMO E1 subunits and of the holo-enzyme.
20974480 2011 Human importin alpha and RNA do not compete for binding to influenza A virus nucleoprotein.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20406804 2010 Probing the specificity of binding to the major nuclear localization sequence-binding site of importin-alpha using oriented peptide library screening.
20193720 2010 Common importin alpha specificity for papillomavirus E2 proteins.
19889762 2010 Ebolavirus VP24 binding to karyopherins is required for inhibition of interferon signaling.
19118899 2009 Karyopherin alpha 1 is a putative substrate of the RAG1 ubiquitin ligase.
19084525 2009 Nuclear import of Pin1 is mediated by a novel sequence in the PPIase domain.
19066626 2008 The host-dependent interaction of alpha-importins with influenza PB2 polymerase subunit is required for virus RNA replication.
19001869 2008 SNP-guided microRNA maps (MirMaps) of 16 common human disorders identify a clinically accessible therapy reversing transcriptional aberrations of nuclear import and inflammasome pathways.
18985028 2008 Hepatitis C virus infection protein network.
18707546 2008 Generation and characterization of a monoclonal antibody against NPI-1 subfamily of importin alpha.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18238777 2008 Multiple nuclear localization signals function in the nuclear import of the transcription factor Nrf2.
17981117 2007 Plasmodium circumsporozoite protein promotes the development of the liver stages of the parasite.
17938174 2007 Sequence elements in both subunits of the DNA fragmentation factor are essential for its nuclear transport.
17928350 2007 Ebola virus VP24 proteins inhibit the interaction of NPI-1 subfamily karyopherin alpha proteins with activated STAT1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16698996 2006 Ebola virus VP24 binds karyopherin alpha1 and blocks STAT1 nuclear accumulation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16439554 2006 Nuclear import of Epstein-Barr virus nuclear antigen 1 mediated by NPI-1 (Importin alpha5) is up- and down-regulated by phosphorylation of the nuclear localization signal for which Lys379 and Arg380 are essential.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16298512 2006 Regulation of Stat3 nuclear import by importin alpha5 and importin alpha7 via two different functional sequence elements.
15942031 2005 Analysis of nuclear transport signals in the human apurinic/apyrimidinic endonuclease (APE1/Ref1).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12783858 2003 Protein profiling with Epstein-Barr nuclear antigen-1 reveals an interaction with the herpesvirus-associated ubiquitin-specific protease HAUSP/USP7.
12740372 2003 Importin alpha nuclear localization signal binding sites for STAT1, STAT2, and influenza A virus nucleoprotein.
12610148 2003 A nonconventional nuclear localization signal within the UL84 protein of human cytomegalovirus mediates nuclear import via the importin alpha/beta pathway.
12504543 2003 Antibody fragments selected by phage display against the nuclear localization signal of the HIV-1 Vpr protein inhibit nuclear import in permeabilized and intact cultured cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414950 2002 Reassessment of the roles of integrase and the central DNA flap in human immunodeficiency virus type 1 nuclear import.
12368302 2002 Nuclear localization of human immunodeficiency virus type 1 preintegration complexes (PICs): V165A and R166A are pleiotropic integrase mutants primarily defective for integration, not PIC nuclear import.
12048190 2002 Arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5.
12011095 2002 EDD, the human hyperplastic discs protein, has a role in progesterone receptor coactivation and potential involvement in DNA damage response.
11927559 2002 Regulated nuclear import of the STAT1 transcription factor by direct binding of importin-alpha.
11904219 2002 Inhibition of nuclear import by backbone cyclic peptidomimetics derived from the HIV-1 MA NLS sequence.
11824786 2001 Core histones and linker histones are imported into the nucleus by different pathways.
11389849 2001 HIV-1 infection requires a functional integrase NLS.
11278458 2001 Characterization of the nuclear import pathway for HIV-1 integrase.
11152524 2001 Nucleocytoplasmic shuttling by human immunodeficiency virus type 1 Vpr.
11060446 2000 Assignment of karyopherin alpha 1 (KPNA1) to human chromosome band 3q21 by in situ hybridization.
11035935 2000 Cellular distribution and karyophilic properties of matrix, integrase, and Vpr proteins from the human and simian immunodeficiency viruses.
10964507 2000 Heat-shock protein 70 can replace viral protein R of HIV-1 during nuclear import of the viral preintegration complex.
10888660 2000 Two putative alpha-helical domains of human immunodeficiency virus type 1 Vpr mediate nuclear localization by at least two mechanisms.
10888652 2000 The karyophilic properties of human immunodeficiency virus type 1 integrase are not required for nuclear import of proviral DNA.
10860744 2000 Two nuclear localization signals in the HIV-1 matrix protein regulate nuclear import of the HIV-1 pre-integration complex.
10772949 2000 Intranuclear binding by the HIV-1 regulatory protein VPR is dependent on cytosolic factors.
10748034 2000 BSAP (Pax5)-importin alpha 1 (Rch1) interaction identifies a nuclear localization sequence.
10525473 1999 HIV-1 nuclear import: in search of a leader.
10366569 1999 Nuclear localization of human immunodeficiency virus type 1 integrase expressed as a fusion protein with green fluorescent protein.
9918876 1999 Phenotype of HIV-1 lacking a functional nuclear localization signal in matrix protein of gag and Vpr is comparable to wild-type HIV-1 in primary macrophages.
9817747 1998 Characterization of HIV-1 vpr nuclear import: analysis of signals and pathways.
9695948 1998 Crystallographic analysis of the recognition of a nuclear localization signal by the nuclear import factor karyopherin alpha.
9603322 1998 A role for human immunodeficiency virus type 1 Vpr during infection of peripheral blood mononuclear cells.
9593140 1998 CNI-H0294, a nuclear importation inhibitor of the human immunodeficiency virus type 1 genome, abrogates virus replication in infected activated peripheral blood mononuclear cells.
9582382 1998 Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.
9562972 1998 HIV-1 nuclear import: matrix protein is back on center stage, this time together with Vpr.
9557700 1998 The putative alpha helix 2 of human immunodeficiency virus type 1 Vpr contains a determinant which is responsible for the nuclear translocation of proviral DNA in growth-arrested cells.
9548947 1998 Backbone cyclic peptide, which mimics the nuclear localization signal of human immunodeficiency virus type 1 matrix protein, inhibits nuclear import and virus production in nondividing cells.
9463369 1998 Viral protein R regulates nuclear import of the HIV-1 pre-integration complex.
9436978 1998 HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.
9366553 1997 HIV-1 nuclear import: in search of a leader.
9303297 1997 HIV-1 infection of non-dividing cells: evidence that the amino-terminal basic region of the viral matrix protein is important for Gag processing but not for post-entry nuclear import.
9282826 1997 HIV-1 p17 and IFN-gamma both induce fructose 1,6-bisphosphatase.
9275210 1997 HIV-1 infection of nondividing cells through the recognition of integrase by the importin/karyopherin pathway.
9261351 1997 Nuclear import, virion incorporation, and cell cycle arrest/differentiation are mediated by distinct functional domains of human immunodeficiency virus type 1 Vpr.
9110174 1997 Large-scale concatenation cDNA sequencing.
9020149 1997 Differential expression and sequence-specific interaction of karyopherin alpha with nuclear localization sequences.
9008157 1997 Phosphorylation of residue 131 of HIV-1 matrix is not required for macrophage infection.
8876228 1996 Critical role of reverse transcriptase in the inhibitory mechanism of CNI-H0294 on HIV-1 nuclear translocation.
8692858 1996 The binding site of karyopherin alpha for karyopherin beta overlaps with a nuclear localization sequence.
8659115 1996 Evidence for direct association of Vpr and matrix protein p17 within the HIV-1 virion.
8631802 1996 The nuclear localization signal of lymphoid enhancer factor-1 is recognized by two differentially expressed Srp1-nuclear localization sequence receptor proteins.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8552640 1996 Phosphorylation-dependent human immunodeficiency virus type 1 infection and nuclear targeting of viral DNA.
8551560 1996 Role of the karyopherin pathway in human immunodeficiency virus type 1 nuclear import.
8529100 1995 Nuclear localization signal of HIV-1 as a novel target for therapeutic intervention.
8105392 1993 A nuclear localization signal within HIV-1 matrix protein that governs infection of non-dividing cells.
8052633 1994 RAG-1 interacts with the repeated amino acid motif of the human homologue of the yeast protein SRP1.
8041786 1994 The Vpr protein of human immunodeficiency virus type 1 influences nuclear localization of viral nucleic acids in nondividing host cells.
8041734 1994 The nuclear localization signal of the matrix protein of human immunodeficiency virus type 1 allows the establishment of infection in macrophages and quiescent T lymphocytes.
7892216 1995 Previously identified protein of uncertain function is karyopherin alpha and together with karyopherin beta docks import substrate at nuclear pore complexes.
7859280 1995 HIV-1 infection of nondividing cells: C-terminal tyrosine phosphorylation of the viral matrix protein is a key regulator.
7831767 1995 NPI-1, the human homolog of SRP-1, interacts with influenza virus nucleoprotein.
7754385 1995 Identification of hSRP1 alpha as a functional receptor for nuclear localization sequences.
7745752 1995 Role of the basic domain of human immunodeficiency virus type 1 matrix in macrophage infection.
7604027 1995 Mammalian karyopherin alpha 1 beta and alpha 2 beta heterodimers: alpha 1 or alpha 2 subunit binds nuclear localization signal and beta subunit interacts with peptide repeat-containing nucleoporins.
7585960 1995 HIV nuclear import is governed by the phosphotyrosine-mediated binding of matrix to the core domain of integrase.
7559393 1995 Nuclear import of influenza virus RNA can be mediated by viral nucleoprotein and transport factors required for protein import.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
2064827 1991 p17 and p17-containing gag precursors of input human immunodeficiency virus are transported into the nuclei of infected cells.
1985200 1991 Two signals mediate nuclear localization of influenza virus (A/WSN/33) polymerase basic protein 2.
1631159 1992 Active nuclear import of human immunodeficiency virus type 1 preintegration complexes.