Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.15
PubTator Score 0.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.931 4.3e-09
non-small cell lung cancer 1.568 2.8e-25
intraductal papillary-mucinous adenoma (... 1.200 5.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
lung cancer 2.300 1.5e-04
group 3 medulloblastoma 1.200 5.9e-04
Breast cancer 1.100 2.3e-11
ductal carcinoma in situ 1.100 4.3e-03
invasive ductal carcinoma 1.500 1.4e-04
acute myeloid leukemia -1.100 3.5e-02

Synonym

Accession Q1ED39 O43328 Q5FWF3
Symbols TSG118
FAM191A
101F10.1
C16orf88

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif downregulates the expression of lysine-rich nucleolar protein 1 (C16orf88, KNOP1) in Vif-expression T cells

AA Sequence

MITKTHKVDLGLPEKKKKKKVVKEPETRYSVLNNDDYFADVSPLRATSPSKSVAHGQAPEMPLVKKKKKK      1 - 70
KKGVSTLCEEHVEPETTLPARRTEKSPSLRKQVFGHLEFLSGEKKNKKSPLAMSHASGVKTSPDPRQGEE     71 - 140
ETRVGKKLKKHKKEKKGAQDPTAFSVQDPWFCEAREARDVGDTCSVGKKDEEQAALGQKRKRKSPREHNG    141 - 210
KVKKKKKIHQEGDALPGHSKPSRSMESSPRKGSKKKPVKVEAPEYIPISDDPKASAKKKMKSKKKVEQPV    211 - 280
IEEPALKRKKKKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASE    281 - 350
TRKWTGTQFGQWDTAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDY    351 - 420
DRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKLED                                    421 - 458
//

Text Mined References (15)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.