Property Summary

NCBI Gene PubMed Count 40
PubMed Score 151.77
PubTator Score 46.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.946 8.5e-04
adult high grade glioma 1.600 3.7e-04
Astrocytoma, Pilocytic 1.300 2.9e-06
Atopic dermatitis 2.000 1.3e-05
atypical teratoid / rhabdoid tumor 1.700 1.8e-07
Breast cancer 2.400 6.0e-18
breast carcinoma 1.200 3.6e-37
ductal carcinoma in situ 2.000 1.1e-03
Endometriosis 1.572 1.6e-02
ependymoma 1.900 3.6e-09
glioblastoma 1.300 2.9e-05
group 3 medulloblastoma 1.400 5.4e-04
intraductal papillary-mucinous carcinoma... 1.100 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.700 1.6e-03
invasive ductal carcinoma 2.100 1.0e-04
medulloblastoma, large-cell 1.800 1.4e-05
nasopharyngeal carcinoma 1.200 5.4e-04
non-small cell lung cancer 2.392 1.0e-23
osteosarcoma -2.180 3.3e-02
ovarian cancer 1.100 8.3e-09
pancreatic cancer 1.100 2.8e-04
primitive neuroectodermal tumor 2.000 7.2e-05
psoriasis 1.200 3.4e-09

 MGI Phenotype (1)

Gene RIF (21)

AA Sequence

MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVSFADTIKVFQT      1 - 70
ESHMKIVRKSEMEGCSAMVPSQLQLLPPGFKRFSCLSLPETETGENLLLIQNKKLEDNYCEITGMNTLLS     71 - 140
APIHTQMQQKEFSIIEHTRERKHANDQTVIFSDENQMDLTSSHTVMITKGLLDNPISEKSTKIDTTSFLA    141 - 210
NLKLHTEDSRMKKEVNFSVDQNTSSENKIDFNDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASST    211 - 280
HQMHVSLKEDENNSNITRLFREKDDGMNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFN    281 - 350
HTLQILPATGNFSEIENQTQNAMDVTTGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAE    351 - 420
THIVSQTCNQDARILAMTPESIYSNPSIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLKHDSNYAKMYC    421 - 490
NPDAMSSLTEKTIYSGEENMDITKSHTVAIDNQIFKQDQSNVQIAAAPTPEKEMMLQNLMTTSEDGKMNV    491 - 560
NCNSVPHVSKERIQQSLSNPLSISLTDRKTELLSGENMDLTESHTSNLGSQVPLAAYNLAPESTSESHSQ    561 - 630
SKSSSDECEEITKSRNEPFQRSDIIAKNSLTDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVY    631 - 700
CGGVLDKQITNRNTVSWEQSLFSTTKPLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPT    701 - 770
PDYCHDKMIICSEEEQNMDLTKSHTVVIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIE    771 - 840
KSGVLKSNCIMDVLEDESVQKPKFPKEKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDITKSYTIEINH    841 - 910
RPLLEKRDCHLVPLAGTSETILYTCRQDDMEITRSHTTALECKTVSPDEITTRPMDKTVVFVDNHVELEM    911 - 980
TESHTVFIDYQEKERTDRPNFELSQRKSLGTPTVICTPTEESVFFPGNGESDRLVANDSQLTPLEEWSNN    981 - 1050
RGPVEVADNMELSKSATCKNIKDVQSPGFLNEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMV   1051 - 1120
EIDNESALEDKEDFHLAGASKTILYSCGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDL   1121 - 1190
EVTDSHTVFIDCQATEKILEENPKFGIGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLF   1191 - 1260
AATNRTTNEIIKFHSAAMDEKVIGKVVDQACTLEKAQVESCQLNNRDRRNVDFTSSHATAVCGSSDNYSC   1261 - 1330
LPNVISCTDNLEGSAMLLCDKDEEKANYCPVQNDLAYANDFASEYYLESEGQPLSAPCPLLEKEEVIQTS   1331 - 1400
TKGQLDCVITLHKDQDLIKDPRNLLANQTLVYSQDLGEMTKLNSKRVSFKLPKDQMKVYVDDIYVIPQPH   1401 - 1470
FSTDQPPLPKKGQSSINKEEVILSKAGNKSLNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTT   1471 - 1540
NYNTALDFHSNSDVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPE   1541 - 1610
QLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFL   1611 - 1680
PRLPNKRNCSVTGIDDLEQIPADTTDINHLETQPVSSKDSGIGSVAGKLNLSPSQYINEENLPVYPDEIN   1681 - 1750
SSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKEKKIRKNEIKFSDTTQDREIF   1751 - 1820
DHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTSLDFSTYRSSQMESQFLRDTICEESLREKLQ   1821 - 1890
DGRITIREFFILLQVHILIQKPRQSNLPGNFTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEEL   1891 - 1960
KLSASNQDKLLVDINKNLWEKMRHCSDKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNE   1961 - 2030
REKLQIKIDEMDKILKKIDNCLTEMETETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLL   2031 - 2100
ELEVQKEQTLAQIDFMQKQRNRTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFL   2101 - 2170
DKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLG   2171 - 2240
EEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIA   2241 - 2310
TILSKVPLENNYLKNVVKQIYQDLFQDCHFYH                                         2311 - 2342
//

Text Mined References (47)

PMID Year Title