Property Summary

Ligand Count 1
NCBI Gene PubMed Count 20
PubMed Score 14.29
PubTator Score 10.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.000 6.2e-06
Amyotrophic lateral sclerosis 1.013 9.3e-08
atypical teratoid / rhabdoid tumor 1.100 2.4e-04
Breast cancer -1.100 1.9e-07
gastric cancer 1.300 1.1e-03
glioblastoma -1.100 1.1e-03
group 3 medulloblastoma 1.900 4.7e-06
hepatocellular carcinoma 1.600 8.5e-06
intraductal papillary-mucinous adenoma (... 1.100 2.2e-02
juvenile dermatomyositis 1.041 2.3e-10
osteosarcoma 1.644 3.5e-05
ovarian cancer -1.600 3.0e-06
Pick disease 1.100 2.8e-05
primitive neuroectodermal tumor 1.300 2.9e-03
spina bifida -1.120 4.3e-02
tuberculosis and treatment for 6 months -1.700 8.5e-05
Waldenstrons macroglobulinemia 1.132 2.0e-02

Gene RIF (10)

AA Sequence

MKWLGESKIMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGFEGQSRYVPSS      1 - 70
GMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEV     71 - 140
IERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGA    141 - 210
KIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCK    211 - 280
FVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYG    281 - 350
LRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA    351 - 420
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEPKVVLYKNLPI    421 - 490
KKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRRSVRTRTNLKEASDIKLEPNT    491 - 560
LNGYKSSVTEPCPDSGEQLQPAPVLQEEELAHETAQKGEAKCHKSDTGMSKKKSRQGKLVKQFAKIEEST    561 - 630
PVHDSPGKDDAVPDLMGPHSDQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRI    631 - 700
TRYDAQLILENNSGIPKLTLRRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGS    701 - 770
GSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD    771 - 840
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA                             841 - 885
//

Text Mined References (25)

PMID Year Title