Property Summary

NCBI Gene PubMed Count 58
PubMed Score 62.52
PubTator Score 79.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.3e-10
Disease Target Count Z-score Confidence
Cancer 2346 3.107 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -3.046 2.3e-10

Gene RIF (45)

PMID Text
26953260 analysis of a structural model for how Set8 uses multivalent interactions to bind and methylate the nucleosome based on crystallographic and solution studies of the Set8/nucleosome complex
26717907 SET8 and ZEB1 are functionally interdependent in promoting the epithelial-mesenchymal transition and enhancing the invasive potential of prostate cancer cells in vitro.
26707641 Overall, the results revealed that miR-127-3p acts as a tumor suppressor and that its down-regulation in cancer may contribute to OS progression and metastasis.
26666832 This study showed SCF(beta-TRCP) earmarks Set8 for ubiquitination and degradation in a casein kinase I-dependent manner, which is activated by DNA-damaging agents.
26634528 SET8 expression is associated with overall survival in gastric cancer
25343552 The SNP in the miR502 binding site of the SET8 3'-untranslated region seems to influence survival of non-Hodgkin's lymphoma.
25252681 SET8 is required for 53BP1 recruitment and efficient repair of DSB.
25169478 These data suggest that there are significant associations between the miR-502-binding site single nucleotide polymorphism in the 3'-UTR of SET8 and the TP53 codon 72 polymorphism with cervical cancer in Chinese, and there is a gene-gene interaction.
25137013 commonality of SPS8I1-3 against SETD8, together with their distinct structures and mechanisms for SETD8 inhibition, argues for the collective application of these compounds as SETD8 inhibitors
25048968 Our results demonstrated that SETD8 rs16917496 C/T polymorphism was associated with decreased risk of developing pediatric acute lymphoblastic leukemia
24937452 Therefore, we conclude that SET8 is involved in AR-mediated transcription activation, possibly through its interaction with AR and H4K20me1 modification.
24459145 PR-SET7 and H4K20me1 are required for establishing both the H4K16Ac and H4K20me3 marks and have a dual role in the local regulation of Pol II pausing
24374662 significant association between the polymorphism (rs16917496) of the miR-502-binding site in the 3'-UTR of SET8 and TP53 codon 72 polymorphism and the risk of developing NSCLC.
24146953 Genetic variation in a microRNA-502 minding site in SET8 gene confers clinical outcome of non-small cell lung cancer in a Chinese population.
24019522 all of the H3K36-specific methyltransferases, including ASH1L, HYPB, NSD1, and NSD2 were inhibited by ubH2A, whereas the other histone methyltransferases, including PRC2, G9a, and Pr-Set7 were not affected by ubH2A.
23720754 a molecular mechanism for the regulation of SET8 and extend the biological function of microRNA-7 to DNA damage response
23706821 Data indicate the Set8-Numb-p53 signaling axis as an important regulatory pathway for apoptosis and suggests a therapeutic strategy by targeting Numb methylation.
23478445 Migration of epithelial cells is stimulated by CRL1(FBXO11)-mediated downregulation of Cdt2 and the consequent stabilization of Set8.
23419719 Data indicate that DDX21, a nucleolar protein, was confirmed to associate with SET8.
23291132 miR-502-binding SNP in SET8 may modulate SET8 expression and contribute to early development of breast cancer.
23152447 PR-Set7 is an important downstream effector of CRL4(Cdt2) function during origin of DNA replication licensing, dependent on Suv4-20h1/2 activity
22867998 SET8 CC genotype was associated with a decreased risk of EOC in this case-control study. The analysis of genetic polymorphisms in miRNA binding sites may help identify subgroups of populations that are at high risk for EOC
22583696 long recognition sequence of SET8 makes it difficult to methylate a lysine in a folded region of a protein
22556262 An increase of methylated PCNA was found in cancer cells, and the expression levels of SETD8 and PCNA were correlated in cancer tissue samples
22095217 SET8 modifies hepatocellular carcinoma outcome by altering its expression, which depends, at least in part, on its binding affinity with miR-502.
21983900 in breast carcinoma samples, SET8 expression is positively correlated with metastasis
21282610 SET8 is a Wnt signaling mediator and is recruited by LEF1/TCF4 to regulate the transcription of Wnt-activated genes, possibly through H4K20 monomethylation at the target gene promoters.
21220508 The turnover of SET8 is accelerated after ultraviolet irradiation dependent on the CRL4(CDT2) ubiquitin ligase and PCNA.
21200139 [review] PR-Set7/Set8/KMT5a is the sole histone methyltransferase responsible for the monomethylation of histone H4 lysine 20 (H4K20me1) in higher eukaryotes.
21035370 PR-Set7 is transiently recruited to laser-induced DNA damage sites through its interaction with PCNA, after which 53BP1 is recruited dependent on PR-Set7 catalytic activity.
20953199 The results elucidate a critical role for PR-Set7 and H4K20me1 in the chromatin events that regulate replication origins.
20932472 CRL4(Cdt2)-dependent destruction of Set8 in S phase preserves genome stability by preventing aberrant chromatin compaction during DNA synthesis.
20932471 Results demonstrate a central role of CRL4(Cdt2)-dependent cell-cycle regulation of Set8 for the maintenance of a stable epigenetic state essential for cell viability.
20932471 This study identifies CRL4-Cdt2 ubiquitin ligase to promote the ubiquitin-dependent proteolysis of the histone H4 methyltransferase Set8 during S-phase of the cell cycle and after UV-irradiation in a reaction that is dependent on PCNA.
20870725 SET8-mediated methylation of p53 at Lys-382 promotes the interaction between L3MBTL1 and p53 in cells.
19789321 The miR-502-binding site single-nucleotide polymorphism in the 3'-UTR of SET8 modulates SET8 expression and contributes to the early development of breast cancer.
18512960 Data show that bond-order computations establish that the H4-K20 monomethylation in SET8 is a concerted linear S(N)2 displacement reaction.
18480059 PR-Set7 enzymatic activity is essential for mammalian cell cycle progression and for the maintenance of genomic stability, most likely by monomethylating histone H4K20.
18418072 SET8 plays a role in controlling G1/S transition by blocking lysine acetylation in histone through binding to H4 N-terminal tail.
18408754 H4K20 monomethylation and PR-SET7 are important for L3MBTL1 function
18319261 the SET8 and PCNA interaction couples H4-K20 methylation with DNA replication
18166648 Overall, we show that SET8 is essential for genomic stability in mammalian cells and that decreased expression of SET8 results in DNA damage and Chk1-dependent S-phase arrest.
17707234 This study identifies SET8 as a p53-modifying enzyme, monomethylating p53 at lysine 382(p53K382me1) and identifying (p53K382me1) as a regulatory posttranslational modification of p53.
15964846 coordination between the amino acid sequence RHRK20VLRDN and the SET domain of SET8 determines the substrate specificity and multiplicity of methylation of lysine 20 of H4
15933070 crystal structure of SET8 bound to a histone H4 peptide bearing Lys-20 and the product cofactor S-adenosylhomocysteine

AA Sequence

MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAAAAVAATAPGP      1 - 70
EMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKR     71 - 140
NAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRK    141 - 210
KAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRG    211 - 280
DFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKL    281 - 350
HDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH                               351 - 393
//

Text Mined References (65)

PMID Year Title
26953260 2016 Multivalent Interactions by the Set8 Histone Methyltransferase With Its Nucleosome Substrate.
26717907 2016 SET8 induces epithelial?mesenchymal transition and enhances prostate cancer cell metastasis by cooperating with ZEB1.
26707641 2016 MicroRNA-127-3p inhibits proliferation and invasion by targeting SETD8 in human osteosarcoma cells.
26666832 2015 SCF(?-TRCP) promotes cell growth by targeting PR-Set7/Set8 for degradation.
26634528 2015 SET8 expression is associated with overall survival in gastric cancer.
25343552 Prognostic value of microRNA 502 binding site SNP in the 3'-untranslated region of the SET8 gene in patients with non-Hodgkin's lymphoma.
25252681 2014 SET8 methyltransferase activity during the DNA double-strand break response is required for recruitment of 53BP1.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25169478 2014 Association of a miR-502-binding site single nucleotide polymorphism in the 3'-untranslated region of SET8 and the TP53 codon 72 polymorphism with cervical cancer in the Chinese population.
25137013 2014 Small-molecule inhibitors of SETD8 with cellular activity.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25048968 2014 Association of functional polymorphism at the miR-502-binding site in the 3' untranslated region of the SETD8 gene with risk of childhood acute lymphoblastic leukemia, a preliminary report.
24937452 2014 Histone H4 Lys 20 methyltransferase SET8 promotes androgen receptor-mediated transcription activation in prostate cancer.
24459145 2014 A dual role for the histone methyltransferase PR-SET7/SETD8 and histone H4 lysine 20 monomethylation in the local regulation of RNA polymerase II pausing.
24374662 2014 Association of miR-502-binding site single nucleotide polymorphism in the 3'-untranslated region of SET8 and TP53 codon 72 polymorphism with non-small cell lung cancer in Chinese population.
24146953 2013 Genetic variation in a microRNA-502 minding site in SET8 gene confers clinical outcome of non-small cell lung cancer in a Chinese population.
24019522 2013 Histone H2A ubiquitination inhibits the enzymatic activity of H3 lysine 36 methyltransferases.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23720754 2013 microRNA-7 suppresses the invasive potential of breast cancer cells and sensitizes cells to DNA damages by targeting histone methyltransferase SET8.
23706821 2013 Dynamic methylation of Numb by Set8 regulates its binding to p53 and apoptosis.
23478445 2013 CRL1-FBXO11 promotes Cdt2 ubiquitylation and degradation and regulates Pr-Set7/Set8-mediated cellular migration.
23468428 2013 The tumor suppressor SirT2 regulates cell cycle progression and genome stability by modulating the mitotic deposition of H4K20 methylation.
23419719 2013 Proteome identification of proteins interacting with histone methyltransferase SET8.
23291132 2012 [SNP rs16917496 within SET8 3'UTR is associated with the age of onset of breast cancer].
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152447 2012 The role of PR-Set7 in replication licensing depends on Suv4-20h.
22867998 A polymorphism at the miR-502 binding site in the 3' untranslated region of the SET8 gene is associated with the risk of epithelial ovarian cancer.
22583696 2012 The SET8 H4K20 protein lysine methyltransferase has a long recognition sequence covering seven amino acid residues.
22556262 2012 Histone lysine methyltransferase SETD8 promotes carcinogenesis by deregulating PCNA expression.
22095217 2012 A polymorphism at the miR-502 binding site in the 3'-untranslated region of the histone methyltransferase SET8 is associated with hepatocellular carcinoma outcome.
21983900 2012 SET8 promotes epithelial-mesenchymal transition and confers TWIST dual transcriptional activities.
21282610 2011 Histone H4 Lys 20 monomethylation by histone methylase SET8 mediates Wnt target gene activation.
21220508 2011 SET8 is degraded via PCNA-coupled CRL4(CDT2) ubiquitylation in S phase and after UV irradiation.
21200139 2011 A new regulator of the cell cycle: the PR-Set7 histone methyltransferase.
21035370 2010 Regulation of the histone H4 monomethylase PR-Set7 by CRL4(Cdt2)-mediated PCNA-dependent degradation during DNA damage.
20953199 2010 The histone H4 Lys 20 methyltransferase PR-Set7 regulates replication origins in mammalian cells.
20932472 2010 CRL4(Cdt2)-mediated destruction of the histone methyltransferase Set8 prevents premature chromatin compaction in S phase.
20932471 2010 CRL4(Cdt2) regulates cell proliferation and histone gene expression by targeting PR-Set7/Set8 for degradation.
20870725 2010 The MBT repeats of L3MBTL1 link SET8-mediated p53 methylation at lysine 382 to target gene repression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19789321 2009 An miR-502-binding site single-nucleotide polymorphism in the 3'-untranslated region of the SET8 gene is associated with early age of breast cancer onset.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18512960 2008 Product specificity and mechanism of protein lysine methyltransferases: insights from the histone lysine methyltransferase SET8.
18480059 2008 Catalytic function of the PR-Set7 histone H4 lysine 20 monomethyltransferase is essential for mitotic entry and genomic stability.
18474616 2008 PR-Set7 establishes a repressive trans-tail histone code that regulates differentiation.
18418072 2008 SET8 plays a role in controlling G1/S transition by blocking lysine acetylation in histone through binding to H4 N-terminal tail.
18408754 2008 Histone H4 lysine 20 monomethylation promotes transcriptional repression by L3MBTL1.
18319261 2008 Direct interaction between SET8 and proliferating cell nuclear antigen couples H4-K20 methylation with DNA replication.
18166648 2007 The histone methyltransferase SET8 is required for S-phase progression.
17707234 2007 Modulation of p53 function by SET8-mediated methylation at lysine 382.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16517599 2006 A trans-tail histone code defined by monomethylated H4 Lys-20 and H3 Lys-9 demarcates distinct regions of silent chromatin.
15964846 2005 SET8 recognizes the sequence RHRK20VLRDN within the N terminus of histone H4 and mono-methylates lysine 20.
15933070 2005 Structural and functional analysis of SET8, a histone H4 Lys-20 methyltransferase.
15933069 2005 Specificity and mechanism of the histone methyltransferase Pr-Set7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200950 2004 A switch in mitotic histone H4 lysine 20 methylation status is linked to M phase defects upon loss of HCF-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12540855 2003 Structure and catalytic mechanism of the human histone methyltransferase SET7/9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411495 2002 Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function.
12208845 2002 Mitotic-specific methylation of histone H4 Lys 20 follows increased PR-Set7 expression and its localization to mitotic chromosomes.
12121615 2002 Purification and functional characterization of SET8, a nucleosomal histone H4-lysine 20-specific methyltransferase.
12086618 2002 PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.
8980232 1996 The TAF(II)250 subunit of TFIID has histone acetyltransferase activity.