Property Summary

NCBI Gene PubMed Count 22
PubMed Score 104.92
PubTator Score 63.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis -1.617 8.0e-03
oligodendroglioma -1.200 3.8e-02
cutaneous lupus erythematosus 3.600 1.1e-04
osteosarcoma -2.658 3.9e-08
glioblastoma 1.200 9.7e-04
tuberculosis and treatment for 6 months -4.300 1.7e-05
pancreatic ductal adenocarcinoma liver m... -1.319 4.7e-02
non-small cell lung cancer -2.050 4.3e-14
lung cancer -3.100 1.4e-04
Multiple Sclerosis 1.300 5.7e-03
interstitial cystitis 2.600 5.7e-03
cystic fibrosis -1.900 5.8e-04
adult high grade glioma 1.400 8.5e-04
primary Sjogren syndrome 1.500 3.0e-03
lung carcinoma -2.900 1.8e-18
breast carcinoma 2.100 3.6e-26
Breast cancer 2.400 1.2e-05
ductal carcinoma in situ 4.000 1.1e-03
invasive ductal carcinoma 3.400 1.9e-04
ulcerative colitis 1.900 4.0e-05
head and neck cancer and chronic obstruc... 1.300 6.8e-03
psoriasis 1.200 8.5e-24

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (13)

PMID Text
26099564 These results suggest that KMO exhibits tumor-promoting effects towards hepatocellular carcinoma (HCC) and it may serve as a novel prognostic marker in HCC.
25715464 Two KMO SNPs were observed more often in schizophrenia patient group compared with healthy controls.
25464917 Results suggest that KMO variation influences a range of cognitive domains known to predict functional outcome in schizophrenia
24316190 Study reporting on the first successful bacterial (Escherichia coli) expression of active FLAGtrade mark-tagged human KMO enzyme expressed in the soluble fraction and progress towards its purification.
23459468 findings from five independent cohorts suggest that genetic variation in KMO influences the risk for psychotic features in mania of bipolar disorder patients.
21727251 significant and correlated reduction in gene expression and enzyme activity in the frontal eye field in schizophrenia patients; rs2275163 has modest effects on predictive pursuit and visuospatial working memory endophenotypes
21693093 analyzed association between KMO gene polymorphisms and CSF concentrations of kynurenic acid in patients with schizophrenia and controls. results suggest that the nonsynonymous KMO SNP rs1053230 influences CSF concentrations of KYNA.
21030213 The present analysis of the combined Scandinavian sample did not reveal any allele frequency difference between patients and healthy controls
21030213 Observational study of gene-disease association. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
16716206 Observational study of gene-disease association. (HuGE Navigator)
16716206 Results suggest that kynurenine 3-monooxygenase is unlikely to be related to the development of schizophrenia in Japanese.
15950064 the function KMO AND indoleamine 2,3-dioxygenase may change from a role in immunosuppression at the maternal-fetal interface in early pregnancy, to one associated with regulation of fetoplacental blood flow or placental metabolism in late gestation

AA Sequence

MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSHRGRQALKAVG      1 - 70
LEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCN     71 - 140
PEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEP    141 - 210
NYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLL    211 - 280
PAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRI    281 - 350
PDDHAISDLSMYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK    351 - 420
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQISNLISR        421 - 486
//

Text Mined References (22)

PMID Year Title
26099564 2015 Prognostic significance of kynurenine 3-monooxygenase and effects on proliferation, migration, and invasion of human hepatocellular carcinoma.
25715464 2014 [Association of kynurenine-3-monooxygenase gene with schizophrenia].
25464917 2014 Influence of kynurenine 3-monooxygenase (KMO) gene polymorphism on cognitive function in schizophrenia.
24316190 2014 Bacterial expression of human kynurenine 3-monooxygenase: solubility, activity, purification.
23459468 2014 The KMO allele encoding Arg452 is associated with psychotic features in bipolar disorder type 1, and with increased CSF KYNA level and reduced KMO expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21727251 2011 Downregulated kynurenine 3-monooxygenase gene expression and enzyme activity in schizophrenia and genetic association with schizophrenia endophenotypes.
21693093 2012 Kynurenine 3-monooxygenase polymorphisms: relevance for kynurenic acid synthesis in patients with schizophrenia and healthy controls.
21030213 2011 Kynurenine 3-monooxygenase (KMO) polymorphisms in schizophrenia: an association study.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
16716206 2006 Association study between kynurenine 3-monooxygenase gene and schizophrenia in the Japanese population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15950064 2005 Localisation of indoleamine 2,3-dioxygenase and kynurenine hydroxylase in the human placenta and decidua: implications for role of the kynurenine pathway in pregnancy.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14704851 2004 Enzymology of NAD+ homeostasis in man.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12402501 2002 Endogenous kynurenines as targets for drug discovery and development.
11401433 2001 Characterization of a novel human opsin gene with wide tissue expression and identification of embedded and flanking genes on chromosome 1q43.
10672018 2000 Functional characterization and mechanism of action of recombinant human kynurenine 3-hydroxylase.
9237672 1997 Cloning and functional expression of human kynurenine 3-monooxygenase.