Property Summary

NCBI Gene PubMed Count 282
PubMed Score 31.06
PubTator Score 697.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Melanoma 261

Gene RIF (259)

PMID Text
26791237 Bispecific protein rG7S-MICA recruits natural killer cells and enhances NKG2D-mediated immunosurveillance against hepatocellular carcinoma.
26616050 In conclusion DNT cell can significantly inhibit the growth of pancreatic carcinoma in vivo, and the mechanism may be involved in abnormal expressions of MICA and NKG2D.
26595802 Data show that NK cells derived from HER2-positive breast cancer (BC) patients after treatment with taxane-containing therapy expressed higher levels of NKG2D receptor than before treatment.
26509932 These data underscore that NKG2D downregulation contributes to impaired CD8 T-cell responses in untreated HIV-1 infection.
26508790 These results suggest that NKG2D-DAP10 endocytosis represents a means to decrease cell surface receptor abundance, as well as to control signaling outcome in cytotoxic lymphocytes.
26483398 The reduced cell surface expression of NKG2D in response to engagement by MICA-129Met variants appeared to reduce the severity of acute graft-versus-host disease.
26477527 study indicates a direct NKG2D-dependent stimulatory effect of human CD34+ cells on allogeneic NK cells. These findings may be relevant to the NK-mediated rejection effect in HLA-mismatched hematopoietic stem cell transplantation
26387089 data suggest that STAT3 contributes to NK cell recognition by modulating NKG2D ligands in K562/AO2 cells, which may a mechanism by which cells survive and cause relapse of leukemia.
26372382 Taken together, these results demonstrate that endogenous levels of IFN-alpha secreted by plasmacytoid dendritic cells induce natural killer cells to lyse HIV-1-infected autologous CD4+ primary T cells via the engagement of NKp46 and NKG2D.
26311146 these findings suggest that TGFbetainduced release of soluble MICA leads to downregulation of NKG2D, thereby preventing NK cellmediated cytotoxicity toward renal proximal tubular epithelial cells in renal IRI
26276724 Activated and expanded natural killer cells target osteosarcoma tumor initiating cells in an NKG2D-NKG2DL dependent manner.
26236752 NKG2D signaling leads to NK cell mediated lysis of childhood AML despite high HLA I expression.
26113176 Both mRNA and protein levels of NKG2D, MICA, MICB and ULBP were upregulated in six types of thymomas compared with those in atrophic thymus or proliferating thymus.
26022178 GSK-3 undergoes inhibitory phosphorylation at regulatory serine residues by the engagement of NKG2D and 2B4, either individually or in combination.
25995251 Varicella-Zoster Virus differentially modulates expression of the NKG2D ligands by upregulating MICA expression and reducing ULBP2 and ULBP3 expression in the infected cells.
25983110 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2.
25924638 There was a significant reduction in the percentage of NKG2D+NK cells as well as NKG2D mRNA expression in peripheral blood of metastatic colon cancer patients.
25861030 There was a significant association between congenital cytomegalovirus disease and a single nucleotide polymorphism, Thr72Ala, in NKG2D.
25854581 NKG2D and DNAM-1 receptor-ligand interactions were essential in cytolysis by resting NK cells, as simultaneous blocking of both pathways resulted in almost complete abrogation of the cytotoxicity.
25775242 This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function.
25721293 Sulforaphane induces ROS mediated induction of NKG2D ligands in human cancer cell lines and enhances susceptibility to NK cell mediated lysis.
25597312 NKG2D and DNAM-1 ligand upregulation might sensitize B cells undergoing lytic Epstein-Barr virus replication to NK cell recognition. (Review)
25545687 this study investigates the structural requirements for the recruitment of the human-activating NK-cell receptors NKG2D and 2B4 to detergent-resistant membrane fractions in the murine BA/F3 cell line and in the human NK-cell line NKL.
25473094 This study, using validated and specific antibodies, analyzed the immunohistochemical expression of NKG2D ligands in epithelial neoplasms and their normal counterpart tissues.
25291178 NKG2D may have the capacity to drive high malignancy traits underlying metastatic disease.
25286418 NK cells in chronic lymphocytic leukemia showed an impaired expression of NKG2D receptor and a defective cytotoxic activity.
25258323 monomethylated selenium compounds can modulate the expression of NKG2D ligands in cancer cells, thereby enhancing their recognition and elimination by NKG2D-expressing immune effector cells
25203601 genetic polymorphism may influence the success of pregnancy in Tunisian women
25136121 These findings reveal a previously unidentified immune evasion strategy whereby tumors produce soluble factors that induce NKG2D ligands on myeloid cells, subverting antitumor immune responses.
25092887 competitive interference of NKG2D/DAP10 complexes by truncated NKG2D constitutes a novel mechanism for regulation of NKG2D-mediated function in human CD8(+) T cells and NK cells.
24891320 NKG2D expression in NK cells is regulated at the transcriptional level by STAT3, resulting in a functional NK cell defect in patients with STAT3 mutations.
24846123 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
24841552 Results suggest that ULBP2 is expressed and released from cervical cancer cells by CRF, which regulates NKG2D expression in natural killer cells.
24803550 The distribution of the activating NKG2D receptor in lipid rafts was studied in NK cells. L-plastin plays an important role in the clustering of NKG2D into lipid rafts.
24777763 The importance of NKG2D engagement on NK cells.
24769842 Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients.
24718859 surface up-regulation of NKG2D ligands by human epithelial cells in response to ultraviolet irradiation, osmotic shock, oxidative stress, and growth factor provision is attributable to activation of the epidermal growth factor receptor.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24496997 XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells.
24282598 identify CD4(+)NKG2D(+) cells as a subpopulation of T helper cells with enhanced migratory, encephalitogenic and cytotoxic properties involved in inflammatory CNS lesion development
24203492 Entinostat enhances NK cell killing of cancer cells through upregulation of both NKG2D and its ligands.
24168855 we analyzed the function of the NKG2D receptor in human CD8(+) T cell chemotaxis
24141776 Results show that NKG2D-mediated effects on tumor initiation may represent another factor in the observed overall enhancement of tumor development.
24019170 gammadelta T cells can mediate anticancer immunity via NKG2D-regulated production of sTRAIL.
23994587 Soluble MICA-NKG2D interaction upregulates IFN-gamma production by activated CD3-CD56+ NK cells.
23947399 significant increase within the CD4+NKG2D+ T cell population in CIN 1 patients might be the result of a chronic exposure to viral and/or pro-inflammatory factors, and concomitantly might also influence the clearance of CIN 1-type lesion.
23945543 Oligoclonal expansions of mucosal T cells in Crohn's disease predominate in NKG2D-expressing CD4 T cells.
23913973 The tumor-associated expression of NKG2D ligands helps destroy malignant cells but in advanced cancer, NKG2D & its ligands are targeted for immune invasion & suppression, autocrine stimulation, & progression. Review.
23846901 these data illustrate in vivo that NKG2D is regulated by [Mg2+]i and apparently plays a key role in Epstein-Barr virus control.
23772752 Data suggest that a common polymorphism in MICA (MICA*008)--a ligand for NKG2D--results in protein that exists in soluble and membrane-bound forms and is attached to membranes by glycosylphosphatidylinositol (GPI) which controls transit to exosomes.
23445485 resveratrol consistently upregulated the NKG2D receptor expression and enhanced NKG2D-mediated functions in resting NK cells obtained from healthy individuals
23417963 NKG2D is functionally expressed on CD4CD28(-) and CD8 T-cells in giant cell arteritis and polymyalgia rheumatica. NKG2D-ligands are present in temporal arteries and may co-stimulate NKG2D expressing T-cells.
23413900 Studies indicate that a crosstalk between CTLA-4 and NKG2D can modulate the function of effector CD8+ T cells.
23360454 data describe immune escape mechanism of monoclonal gammopathy/multiple myeloma occuring via downregulation of 3 major activating NK receptors (NCR3/NKp30, NKG2D and CD244/2B4/p38) in bone marrow, that was undetectable in peripheral blood.
23302231 cytotoxic potential of NK cells against a wide spectrum of tumor subtypes could be markedly enhanced by expression of NKG2D-DAP10-CD3zeta receptors
23298273 Results suggest that aberrantly decreased levels of NKG2D expression on NK cells and CD8(+) T cells might be one of the factors led to disturbed immunological function in Kawasaki disease (KD).
23298206 NKG2D is expressed by all natural killer (NK) cells but is not limited to NK cells, as it is also expressed by many T cells, including all CD8-positive T cells in humans.
23235109 These findings suggest that differential NKG2D expression in the different cell subsets is regulated by epigenetic mechanisms.
23202519 HIV-1 Nef-mediated downregulation of NKG2DL triggers decreased signals delivered via NKG2D, which results in a weaker activation of NK cells and in reduced lysis
23115291 Here, the authors show that cowpox virus-encoded OMCP binds the NKG2D homodimer as a monomer and competitively blocks host ligand engagement.
23020627 TGF-beta1 secreted by multipotent mesenchymal stromal cells is responsible for impaired cytotoxic t-cells and natural killer function by down-modulating surface NKG2D expression.
22942430 Decreased expression of NKG2D in transgenic mice in response to IL-4 is associated with inhibition of NKG2D-dependent CD8 T cell activation.
22870231 The ability to express NKG2D at the cell surface was primarily determined by the activation or differentiation status of the CD4(+) T-cells and not by the antigen presenting cells
22806577 Simultaneous knockdown of multiple ligands (MICA/B, ULBP2, and ULBP3) significantly attenuated NK cell cytolysis against human NKG2D ligand-positive hepatocyte L-02 cells.
22798674 Upregulation of NKG2D ligands by H-RasV12 increased sensitivity of cells to NK cell-mediated cytotoxicity
22730533 NKG2DL expression on leukemia cells is relevant for natural kiiller (NK) cell immunosurveillance as well as involvement of soluble NKG2DL in NKG2D downregulation, which results in impaired NK reactivity against leukemia targets.
22715368 IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.
22640649 Report expression of NKG2D and CD107 in CD8(+) effector memory lymphocytes in Churg-Strauss syndrome.
22613008 high killing activity of natural killer cells against K562 was abolished through the addition of a NKG2D blocking antibody
22585739 study describes that both N-WASp and WASp participate in the inhibition of NK-cell chemotaxis in response to NKG2D WASp engagement, and that this effect is not dependent on the regulation of F-actin dynamics
22555808 We conclude that NKG2D-NKG2D ligand interaction may be one of the mechanisms by which CIK cells kill MM cells.
22507622 NKG2D haplotypes are associated with the expression levels of NKG2D protein on NK and CD8 T cells, resulting in inter-individual variations in human cytotoxic response.
22480139 studies may suggest that the women with cervical cancer bearing the NKG2D 72Thr gene variant might be protected against progression to advanced stages of this cancer
22449797 NK cell induction of hepatic stellate cell apoptosis in HCV infection was contact dependent and could partly be blocked by antibodies specific for TRAIL, NKG2D and FasL.
22438812 TGF-beta1 may reduce the expression of NKG2D/DAP10 and 2B4/SAPin patients with hepatitis B.
22384114 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A
22360401 NKG2D levels remain stable on the natural killer cells that persist at one week post-liver transplant in pediatric patients.
22316211 these results suggest that differential expression of NKG2D-ligands in cervical cancer cell lines might be associated with the down-modulation of NKG2D, as well as with changes in the cytotoxic activity of NKL cells after cell-cell contact with the tumor cells.
22304689 results suggest that histamine down-regulates NKG2D ligands through the activation of an histamine H1 receptor (H1R)- and H2R-mediated ubiquitin-proteasome pathway and consequently reduces susceptibility to NK cells
22252158 Decreased number and reduced NKG2D expression of Vdelta1 gammadelta T cells are involved in the impaired function of Vdelta1 gammadelta T cells in the tissue of gastric cancer.
22242197 The expression of CD85j, NKG2D, NKp30, NKp44, KIR2DL1/S1 and KIR2DL2/L3/S2 receptors at the cell surface evolves between 8 and 12 weeks of gestation.
22200673 Data revealed that the decrease in NKG2D expression levels may have been associated with suppression of NK cell activity in CRC patients.
22170554 Several SNPs belonging to NFKB1A and NKG2D showed a trend of association with susceptibility to HTLV-1-associated myelopathy/tropical spastic paraparesis in Peruvian patients.
22167753 Data show that the lymph node (LN) stroma displayed in situ high levels of transcription and expression of the disulfide-isomerase ERp5 and of the disintegrin-metalloproteinase ADAM10, able to shed the ligands for NKG2D (NKG2D-L) from the cell membrane.
22143889 CEACAM1 dampens antitumor immunity by down-regulating NKG2D ligand expression on tumor cells.
22105417 decreased expression is associated with altered NK-cell function in pediatric transplant patients with PTLD
22104546 The NKG2D/ligand interaction is a critical molecular link in the vicious cycle of chronic inflammation and metabolic dysfunction that promotes atherosclerosis.
22102694 Study shows that tumor-suppressive miR-34a and miR-34c act as ULBP2 repressors. Findings also implicate p53 in ULBP2 regulation, emphasizing the role of the specific NKG2DL in tumor immune surveillance
21994772 HIV-1 Nef-mediated downregulation of NKG2DL triggers decreased signals delivered via NKG2D, which results in a weaker activation of NK cells and in reduced lysis
21816829 Other gamma(c) cytokines act similarly to IL-2 in up-regulating DAP10 expression and NKG2D-DAP10 surface expression.
21789015 TGF-BETA1 down-modulates surface NKG2D expression by controlling the transcriptional and translational levels of DAP10.
21712812 In C2GnT-expressing bladder tumour cells galectin-3 bound the NKG2D-binding site of MICA, reducing the affinity of MICA for NKG2D on natural killer cells and hence severely impairing natural killer cell activation.
21706044 HMBOX1 negatively regulates the expression of NKG2D and the activation of the NKG2D/DAP10 signaling pathway in NK cells.
21689246 It is now postulated that the characteristic T cell "swarm of bees" infiltrate seen in alopecia areata is the result of T cells being attracted to the hair follicle by NKG2D-activating ligands
21626292 Decreased NKG2D expression on NK cells may be one of the key mechanisms responsible for NK cell dysfunction in gastric cancer
21600899 NKG2D is a functional marker of CD4+ T cells that produce IL-17 in patients with Crohn's disease, via costimulation of the T-cell receptor and NKG2D.
21598106 The NKG2D 72Thr gene variant may protect against the incidence of systemic lupus erythematosus.
21590763 the CD4- subset of human NKT cells can mediate direct lysis of target cells via NKG2D engagement independent of CD1d, and NKG2D also functions as a co-stimulatory receptor in these cells
21554925 Data indicate that the increased frequency of CD8(+) effector-memory T cells with activating NKR KIR2DS4, NKG2C and NKG2D, and cytotoxicity toward hematopoietic cell lines suggests involvement in bone marrow failure and clonal expansion in PNH.
21518928 NKG2D receptor regulates human effector T-cell cytokine production.
21518478 The positive expression rate of NKG2D and NKG2A on NK cells and CD3(+) T cells in ALL patients was no significantly different from that in AML patients.
21477352 tumor epithelial cells express the NKG2D receptor that was thought to be exclusive to natural killer cells and cytotoxic lymphocytes
21469127 contributes to the anti-infectious activity of Vgamma9Vdelta2 T cells against Brucella suis
21321202 results suggest that tumor co-option of NKG2D immunoreceptor expression may complement the presence of its ligands for stimulation of tumor growth
21307295 Transgenic natural killer (NK) cells shape CD8-positive T cell fate by killing recently activated CD8-positive T cells in a perforin- and NKG2D-dependent manner.
21277902 down-regulation of NKG2D by EBV-induced IDO metabolite provides a potential mechanism by which EBV escapes NKG2D-mediated attack by immune cells.
21179506 Results demonstrate that receptor-ligand dimensions, NKG2D/MICA and KIR2DL1/HLA-C, are important in NK cell recognition.
21115900 Induction of NKG2D ligands by VPA increased the susceptibility of cancer cells that are recognised by NKG2D to cytolysis by gammadelta T-cells.
21085608 Downmodulation of NKG2D is associated with defective NK cell responses through NS5A-mediated imbalance of inflammatory cytokines during Hepatitis C virus infection.
21075351 HIV-1 Nef-mediated downregulation of NKG2DL triggers decreased signals delivered via NKG2D, which results in a weaker activation of NK cells and in reduced lysis
21074271 The polyspecific NKG2D binding site is more tolerant of structural alteration in general than either an antibody-antigen or protein-peptide binding site, and this tolerance may adapt NKG2D to a broad range of protein surfaces with micromolar affinity.
21061445 IL-2-activated haploidentical NK cells restore NKG2D-mediated NK-cell cytotoxicity in neuroblastoma patients by scavenging of plasma MICA.
20959069 Lung cancer has low expression of NKG2D in CD8+NKT cells
20926796 these results indicate that pathological NKG2D ligand expression leads to simultaneous impairment of multiple CD3zeta-dependent receptor functions
20863413 Among gated CD3-expressing cells in bronchoalveolar lavage fluid, the percentage of CD8+ NKG2D+ cells is enhanced in patients with chronic obstructive pulmonary disease and smokers with normal lung function, compared to never-smokers.
20844584 The functional status of CD8+ T cells is determined by CD28 but not NKG2D expression.
20800424 cytokines induce significant up-regulation of NKG2D expression while only IFN-alpha induced significant up-regulation of CD161
20667578 HIV-1 Nef-mediated downregulation of NKG2DL triggers decreased signals delivered via NKG2D, which results in a weaker activation of NK cells and in reduced lysis
20648603 The single nucleotide polymorphism rs2617160 in NKG2D associated with susceptibility to chronic hepatitis B in a Han Chinese population.
20648603 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20530257 In a transgenic mouse model of chronic NKG2D ligand expression, constant exposure to NKG2D ligand RNA export 1 homolog (Rae-1 epsilon) does not functionally impair NK cells or CD8-positive T cells in the context of viral infection.
20519648 An orthopoxvirus histocompatibility class I-like protein binds with high affinity in an NKG2D-independent manner to marginal zone and B1 B cells and monocytes/macrophages, implicating NKG2D in antiorthopoxvirus immunity.
20511557 The protein kinase C transduction pathway is identified as a main regulator of the NKG2D-mediated costimulation of antitumor Vgamma9Vdelta2 cytolytic T cell responses.
20488792 stimulation allows expression of NKG2D ligands through multiple pathways
20460636 MICA-NKG2D played a role in disease pathogenesis in the majority of patients in our cohort of cases of large granular lymphocyte leukemia
20415540 heat shock protein 70 and NKG2D ligands are expresseed in acute myeloid leukemia cell lines
20393128 Inhibition of NKG2D expression in NK cells by cytokines secreted in response to human cytomegalovirus infection.
20354827 the present study has suggested that a deficiency in MICA-NKG2D immune surveillance may contribute to pancreatic cancer progression.
20150362 NKG2D downregulation was primarily caused by tumor-derived tumor growth factor-beta in glioblastoma patients
20080967 analysis of differential mechanisms of shedding of the glycosylphosphatidylinositol (GPI)-anchored NKG2D ligands
20074451 Report decreased phosphorylation of ERK1/2 following decreased expression of NKG2D in human K562 cells exposed to asbestos.
20045334 The immune-escape of pituitary adenoma is related to the down-regulation of NKG2D and the up-regulation of its ligand MICA.
20024547 reduced expression in multiple myeloma patients
20012119 increased CD8+ T-cell subsets as well as the abnormal expression of NKG2A and NKG2D on CD3+ T and CD3-CD56 + NK cells may play a role in the etiology of systemic lupus erythematosus
20008788 Vpr is a key determinant responsible for HIV-1-induced up-regulation of NKG2D ligands
19861434 NKG2D ligands are expressed by the majority of colorectal tumors
19794085 In patients with standard risk hematologic malignancies, the donor NKG2D-HNK1 haplotype is associated with significantly improved overall survival.
19735685 systemic lupus erythematosus is associated with the single-nucleotide polymorphism rs2255336 of NKG2D.
19735685 Observational study of gene-disease association. (HuGE Navigator)
19711124 There is a significant positive correlation of NKG2D expression with NK cytotoxicity.
19658097 ULBP6 bound to recombinant NKG2D
19587005 binding of NKG2D to UL-16 binding protein (ULB)1 contributes to IL-23-dependent IL-17 production by CD4(+) cells in human M. tuberculosis infection.
19569244 Cosuppression of HLA Class I and NKG2D ligands and genes encoding peptide transporters or proteasomal genes mediates between RAS activation, DNMT activity and disruption of the antigen presenting system controlling immune recognition in CRC cells.
19555665 NKG2D and CD94 bind to heparin and sulfate-containing polysaccharides.
19542445 NKG2D ligand-bearing placental exosomes play a role in immune escape of the fetus, supporting the view of placenta as a unique immunosuppressive organ.
19508374 Data show upon HSV-1 infection of cell lines, surface levels of NKG2D ligands MICA antigen and UL16 binding protein 2 were downmodulated due to late viral ICP0 gene product(s).
19498463 On co-culture with some melanomas, activated CD4(+) T cells promoted NKG2D- and NKp46-dependent IFN-gamma secretion by NK cells, probably owing to the capture of NKG2D and NKp46 ligands from the tumour-cell surface (trogocytosis).
19489688 NKG2D, CD158a and CD158b expression in MM patients may represent several clinically useful 'biomarkers' of suppressed NK function.
19454690 an interaction between the regulatory subunit of PI3K, p85, and the adaptor protein CrkL is required for efficient NKG2D-mediated cellular cytotoxicity
19436053 data suggest that ULBP4 functions as a ligand for both TCRgammadelta and NKG2D and may play a key role in immune surveillance of tumor development and clearance of viral infection
19424970 RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold.
19363685 Increased expression of MICA associated with downregulation of the receptor NKG2D contributes to idiopathic pulmonary fibrosis.
19329438 the rapid degradation of NKG2D/DAP10 observed coincident with recruitment of the receptor to the cytotoxic immune synapse may explain the loss of NKG2D receptor expression after chronic exposure to NKG2D ligands
19319200 human Dendritic cell-derived exosomes harbor NKG2D ligands on their surface leading to a direct engagement of NKG2D and NK cell activation
19303396 In this work, the glycan ligands of NKG2D and CD94 for the first time were resolved.
19289577 Immunosuppressive NKG2D(+)CD4(+) T cells appear functionally uncompromised in juvenile-onset systemic lupus erythematosus.
19237603 Cytosolic phospholipase A(2) (cPLA(2)) is identified as a central molecule in NKG2D-mediated cytolysis in cytotoxic T lymphocytes.
19200602 CD14(+) monocytes promote NKG2D(+)CD4(+) T cells activation through the NKG2D-MIC engagement in the pathogenesis of systemic lupus erytematosus.
19155520 Both low NKG2D expression and up-regulation of its ligand MICA are related to reactive oxygen species production and may be involved in the immune deficiency of end-stage renal disease patients.
19140827 KLRK1 is involved in cancer immunosurveillance and possibly in prenatal selection.
19140827 Observational study of genotype prevalence. (HuGE Navigator)
19124832 Activated CD4(+) T cells expressing NKG2DLs can efficiently prevent NKG2D-mediated CD8(+) T-cell functions; this suggest that the NKG2D/NKG2DL interaction can regulate immune responses.
19118515 These findings provide a novel insight into the mechanisms evolved by hepatitis C virus to escape from the natural killer cell response.
19087227 Intrahepatic CD8+ T cells display increased NKG2D expression in chronic viral hepatitis in comparison with circulating CD8+ T cells.
19086992 the NKG2D-of MHC Class I chain-related protein interaction is an important molecular mechanism that is involved in the innate immune response to microbial signals in the human uterine endometr
19038287 NK stimulation with anti-NKGD2 antibodies results in re-organization of mitochondria towards the site of interaction with tumour cells (immune synapse)
19032228 KIR/HLA genotype and expression of NKG2C and NKG2D might play a significant role in regulating natural killer cell function and anti-cytomegalovirus immunity after kidney transplantation.
18941207 Brain-infiltrating natural killer (NK) cells might restrict innate and adaptive immune responses via elimination of resting microglia; this cell killing is dependent on cell contact, NKG2D, and NKp46.
18832705 NKG2D-mediated activation of lung NK cells following respiratory infection with an opportunistic pathogen and further establish the importance of NKG2D in the host response against P. aeruginosa respiratory infection.
18754036 NKG2D expressed on Sezary syndrome patients natural killer cells is functional and capable to induce degranulation
18700876 No significance was observed between the inhibitory (NKG2A) or activating (NKG2C and NKG2D) receptor genotypes and the presence of RF, ANA, or bony erosions in Rheumatoid arthritis.
18700876 Observational study of gene-disease association. (HuGE Navigator)
18658158 the role of NKG2D and 2B4 is not focussed on trophoblast recognition in normal pregnancy, but is more likely involved in cross-talk among maternal cells of the placental bed
18657862 EWS tumor cells are recognized and lysed by resting and with higher efficacy by activated NK cells through NKG2D and DNAM-1 dependent pathways.
18619507 results demonstrate that IL-12 improves the cytotoxicity of NK cells in an NKG2D-dependent manner and augments the expression of cytotoxic effector molecules
18599182 ChNKG2D T cells respond to human myeloma cells and can be generated using clinically applicable cell culture techniques.
18564160 NKG2D expression on CD8+ T cells was significantly inversely correlated with the frequency of CD4_CD25+ Treg cells in esophageal cancer patients.
18508446 Release of NKG2DL has been observed in a broad variety of human tumor entities and is thought to interfere with NKG2D-mediated tumor immunity in several ways[REVIEW]
18490733 findings show macrophage migration inhibitory factor may contribute to the immune escape of ovarian carcinoma by transcriptionally down-regulating NKG2D in vitro and in vivo which impairs NK cell cytotoxicity toward tumor cells
18490724 data show that NKG2D is a likely physiological target for exosome-mediated immune evasion in cancer
18417514 in coculture lysis of bronchial epithelial cells depended on NK group 2 member D signalling; respiratory epithelium has an antigen presenting function and directly alloactivates cytotoxic CD8+ T-cells
18398831 Interactions between NKG2D genotype and lifestyle exposure were statistically significant: opposite impact of NKG2D genotype by lifestyle (drinking and smoking)exposure to the risk of aerodigestive tract cancer among a Japanese population.
18398831 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18398827 NKG2D polymorphisms, previously associated with cholangiocarcinoma, do not seem to confer risk of sporadic colorectal cancer (CRC).
18394936 NKG2D is not necessary for natural killer (NK) cell development but is critical for immunosurveillance of epithelial and lymphoid malignancies in two transgenic models of de novo tumorigenesis.
18361934 Observational study of gene-disease association. (HuGE Navigator)
18360276 NKG2D ligand induction may participate in the amplification loop that leads to tissue damage during acute graft-versus-host disease.
18354183 identifies a novel strategy developed by melanoma cells to evade NK cell-mediated immune surveillance based on the intracellular sequestration of immature forms of MICA in the endoplasmic reticulum
18316620 different types of stress can trigger up-regulated expression of different sets of NKG2D ligands
18313361 Cluster-like formations of "Wegener's autoantigen" PR3 were surrounded by NKG2D+ and NKG2D-ligand MIC+ cells in WG-granulomata, but not in disease controls.
18287244 while infection with wild-type Ad enhances synthesis of the NKG2D ligands, MICA and MICB, their expression on the cell surface is actively suppressed.
18280748 results show that IL-15 can improve the function of NK cells via up-regulating NKG2D expression, and also augmenting the expression of cytotoxic effector molecules and the phosphorylation of STAT1 and ERK1/2, which may also contribute the NK lysis
18275895 in NK cells cultured with IL-15, we observed an up-regulation of the activating receptors NKG2D, NKp30, and NKp46, associated with an increase in anti-tumor lytic activity.
18230726 The down-regulation of ligands for both the NKG2D and NKp80 activation pathways provides KSHV with a powerful mechanism for evasion of NK cell antiviral functions.
18202175 Alterations in the NKG2D pathway are associated with progression from monoclonal gammopathy of undetermined significance to full-blown multiple myeloma.
18174257 the HNK1 genotype, associated with high NK cell activity, might be an independent protective factor for colorectal cancer among the Japanese population
18174257 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18097042 Ap-1 is an important transcription factor for regulating DAP10 gene expression in human NK and T cells, it plays a key role in the transactivation of DAP10 promoter following TCR stimulation.
18094430 NKG2D+ T cells have a role in the immunologic response against tumor
18094399 NKG2D is a biomarker of the status of cytotoxic t-lymphocyte activation in the tumor microenvironment and its expression is relevant to tumor growth
18070447 NKG2D expression in peripheral lymphocytes correlates with the differentiation and stage of osteosarcoma.
18024793 Co-expression of NKG2D and 4-1BB may represent an important biomarker for defining competency of tumor infiltrating CD8(+) T cells
18023027 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18023027 single nucleotide polymorphisms associated with an increased risk of cholangiocarcinoma: rs11053781 and rs2617167
18006849 NKG2D, with cytokines, has a role in inhibiting systemic T-cell lymphoma growth
17991774 blockade of an NKG2D-ligand interaction completely prevents the HBV- and CD1d-dependent, nonclassical NKT cell-mediated acute hepatitis and liver injury
17923698 Engagement of NKG2D by itself is sufficient to stimulate the formation of the natural killer cells immunological synapse (NKIS), with recruitment of NKG2D to the center synapse.
17875681 NK cell-mediated killing of myeloma cell lines was dependent on either DNAM-1 or NKG2D but not both molecules.
17661204 Expression levels of NKG2D ligands in tissues as well as cells, and suggested that the gastrointestinal tumors might be good candidates for natural killer cell-based cancer immunotherapy.
17635809 Results indicate for the first time that the NKG2D pathway is involved in the lysis of different melanomas, pancreatic adenocarcinomas, squamous cell carcinomas of the head and neck, and lung carcinoma.
17625602 upregulation of MICA and MICB by treatment with TsA leads to enhancement of the susceptibility of leukemic cells to the cytotoxicity of NKG2D-expressing cells
17609265 HTLV-1-infected CD4+ T cells did not express ligands for NK cell activating receptors, NCR and NKG2D, although they did express ligands for NK cell coactivating receptors, NTB-A and 2B4.
17584663 Data show that expression of NKG2D ligands MICA and MICB on CNE2 and CNE2/DDP cells is correlated with NK cell-mediated lysis.
17570210 Role of MICA-NKG2D in activation of unique subset of CD4(+) T cells with inflammatory and cytotoxic properties in Crohn's disease.
17470428 free soluble ULBP protein, RAET1E2, that may impair NKG2D-mediated NK cell cytotoxicity to tumors
17405908 Natural killer cell lysis of T lymphocytes via NKG2D may be an additional mechanism to limit T-cell responses.0
17267578 NKG2D-NKG2D ligand interactions can potentially contribute to cytotoxic responses mediated by activated immune effector cells in the inflamed central nervous system, as observed in multiple sclerosis.
17255258 NKG2D expression may have a role in immune evasion by tumors in gastric cancer
17217747 Observational study of gene-disease association. (HuGE Navigator)
17202358 reveal distinct modes of activation of the genes for the MHC class I-related chain ligands of NKG2D and provide a molecular framework for analyses of gene regulation under different cellular insult conditions
17173658 Significant elevated levels of NKG2D mRNA could be further detected in urine sediment prior to acute rejection, suggesting this receptor as a new candidate marker for the diagnosis of acute and chronic allograft rejection.
17170457 HIV-1 Nef-mediated downregulation of NKG2DL triggers decreased signals delivered via NKG2D, which results in a weaker activation of NK cells and in reduced lysis
17109473 Functions as a prototypic costimulatory receptor in a subset of human cytomegalovirus-specific CD4+ T lymphocytes.
17043026 To be fully sensitive to triggering, optimal natural killer (NK) cell reactivity requires a threshold of NKG2D expression above that of receptor levels in resting NK cells.
16914326 Recent insights into the regulation of NKG2D function, the control over NKG2D ligand expression and the role of NKG2D in tumor immunity.
16901903 ULBP1 is a human ligand of the NKG2D receptor
16887974 NKG2D mediates xenogeneic human anti-pig endothelial cell NK cell cytotoxicity by binding to the surface of porcine endothelial cells and to porcine UL16-binding protein 1 (pULBP1).
16849432 NKG2D and MICB in the cytotoxic NK cell immune synapse have roles in NK cell cytotoxic function
16732291 Observations with normal peripheral blood NKG2D(+)CD8(+) T cells demonstrated unrecognized NKG2D-mediated immune functions, whereby FasL release promotes tumor cell death and NKG2D costimulation prolongs T cell survival.
16690951 defect in cytotoxic effector function is associated with a reduced surface expression of activating NK receptors (NKp30, NKp46, and NKG2D) on CD56(dim) NK cells compared with uninfected newborns.
16630603 down-regulation of NKG2D by soluble ULBP provides a potential mechanism by which gastric cancer cells escape NKG2D-mediated attack by the immune cells
16568261 Engagement of MIC by NKG2D promotes spontaneous HAM/TSP T cell proliferation and, apparently, CTL activities against HTLV-1-infected T cells.
16517727 soluble MHC class I chain-related molecules in pregnancy serum were able to interact with NKG2D and down-regulate the receptor on PBMC from healthy donors, with the consequent inhibition of the NKG2D-dependent cytotoxic response
16293707 The role of TLR3 in the immunobiology of muscle is reported; its implications for the understanding of the pathogenesis of inflammatory myopathies or therapeutic interventions are included.
16272287 NKG2D/MHC-I-related stress-inducible molecule A and/or NKG2D/UL-16 binding protein 3 engagement is responsible for the delivery of a lethal hit
16239914 acute myeloid leukemia cells expressed the NKG2D receptor and its signal-transducing adaptator DAP 10, which were functional as confirmed by redirected lysis experiments
16210654 Freshly isolated natural killer (NK) cells lyse porcine endothelial cells exclusively in an NKG2D-dependent fashion; lysis of porcine endothelial cells mediated by activated human NK cells depends on both NKp44 and NKG2D
16136475 expression increased by Il-15 in NK cells
16081780 Remarkable similarities in NKG2D function in natural killer (NK) and Vgamma9 Vdelta2 T cells may open new perspectives for Vgamma9 Vdelta2 T cell-based immunotherapy
15885603 tumor exosome-phenotype showed positive expression of several NKG2D ligands, important in driving the reduction in the proportion of NKG2D-positive effector cells
15814668 NKG2D serves as a costimulatory receptor for TCR induced Ca2+ mobilization and proliferation in naive CD8+ T cells
15699512 Polymorphic MICA in HLA Class I interacts with non-polymorphic NKG2d receptor on NK cells.
15699119 NKG2D engagement by ligand or monoclonal antibody is not sufficient to costimulate naive or effector CD8+ T cell responses in conventional T cell populations.
15657183 NKG2D, NKp30, NKp44, and NKp46 acitvation affected by ligand-negative phenotype in bone marrow-derived progenitor cells, acquisition of cell-surface ligands during myeloid differentiation, defective expression of ligands on malignant transformation
15652646 analysis of functional sites in NKG2D-MICA interaction in mouse and human
15328155 natural cytotoxicity receptor (NCR) and NK receptor member D of the lectin-like receptor family (NKG2D) were the key NK activating receptors for bone marrow-derived myeloma cell recognition
15187109 incubation of NK cells and LAK cells with TGF-beta1 resulted in dramatic reduction of surface NKG2D expression associated with impaired NK cytotoxicity
15070686 NKG2D triggering accounts for the majority of major histocompatibility complex (MHC)-unrestricted cytotoxicity of activated and expanded CD8+ T cells, likely through DAP10-mediated signaling.
15065764 NKG2D structure, ligands, function, and tissue distribution (review)
15051759 Cell surface organization of stress-inducible proteins ULBP and MICA that stimulate human NK cells and T cells via NKG2D.
14523385 NKG2D signalling enhances innate and adaptive immune responses (review)
12902493 In the thymus NKG2D may be a signal allowing newly matured CD8+ T cells to emigrate to the periphery; in thymomas there is a decreased percentage of NKG2D-positive thymocytes, which express a less mature phenotype than in normal thymus.
12732206 ULBP4 is a novel ligand for NKG2D (ULBP4)
12679019 Results suggest that ligands appear to utilize different strategies to interact with structurally conserved elements of the consensus NKG2D binding site.
12646700 Expression of this receptor, inhibited by TGF-beta1, affects NK-mediated killing of dendritic cells
12594848 Selective intracellular retention of virally induced NKG2D ligands by the human cytomegalovirus UL16 glycoprotein.
12384702 binding of MICA and MICB induces endocytosis and downregulation of NKG2D, and in turn severe impairment of the responsiveness of tumour-antigen-specific effector T cells
11777960 NKG2D is the receptor for UL16-binding proteins expressed on primary natural killer cells.

AA Sequence

MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIM      1 - 70
VAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSK     71 - 140
EDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYI    141 - 210
CMQRTV                                                                    211 - 216
//

Text Mined References (289)

PMID Year Title
26791237 2016 A bispecific protein rG7S-MICA recruits natural killer cells and enhances NKG2D-mediated immunosurveillance against hepatocellular carcinoma.
26616050 2016 DNT cell inhibits the growth of pancreatic carcinoma via abnormal expressions of NKG2D and MICA in vivo.
26595802 2016 Taxanes enhance trastuzumab-mediated ADCC on tumor cells through NKG2D-mediated NK cell recognition.
26509932 2015 Expression and Function of NKG2D Is Impaired in CD8+ T Cells of Chronically HIV-1-Infected Patients Without ART.
26508790 2015 Ubiquitin-dependent endocytosis of NKG2D-DAP10 receptor complexes activates signaling and functions in human NK cells.
26483398 2015 The MICA-129 dimorphism affects NKG2D signaling and outcome of hematopoietic stem cell transplantation.
26477527 2016 Human hematopoietic CD34+ progenitor cells induce natural killer cell alloresponses via NKG2D activation.
26387089 2015 STAT3 contributes to NK cell recognition by modulating expression of NKG2D ligands in adriamycin-resistant K562/AO2 cells.
26372382 2015 Lysis of HIV-1-infected autologous CD4+ primary T cells by interferon-alpha-activated NK cells requires NKp46 and NKG2D.
26311146 2015 Transforming growth factor-?1 regulates human renal proximal tubular epithelial cell susceptibility to natural killer cells via modulation of the NKG2D ligands.
26276724 2015 Activated and expanded natural killer cells target osteosarcoma tumor initiating cells in an NKG2D-NKG2DL dependent manner.
26236752 2015 NKG2D Signaling Leads to NK Cell Mediated Lysis of Childhood AML.
26113176 2015 Upregulated expression of NKG2D and its ligands give potential therapeutic targets for patients with thymoma.
26022178 2015 NK cell function triggered by multiple activating receptors is negatively regulated by glycogen synthase kinase-3?.
25995251 2015 Varicella-Zoster Virus and Herpes Simplex Virus 1 Differentially Modulate NKG2D Ligand Expression during Productive Infection.
25983110 2015 A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2.
25924638 2015 The decrease in NKG2D+ Natural Killer cells in peripheral blood of patients with metastatic colorectal cancer.
25861030 2015 A Thr72Ala polymorphism in the NKG2D gene is associated with early symptomatic congenital cytomegalovirus disease.
25854581 2015 Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells.
25775242 2015 Soluble ligands for the NKG2D receptor are released during endometriosis and correlate with disease severity.
25721293 2015 Sulforaphane induces ROS mediated induction of NKG2D ligands in human cancer cell lines and enhances susceptibility to NK cell mediated lysis.
25597312 2014 Role of human natural killer cells during Epstein-Barr virus infection.
25545687 2015 Recruitment of activating NK-cell receptors 2B4 and NKG2D to membrane microdomains in mammalian cells is dependent on their transmembrane regions.
25473094 2015 Immunohistochemical validation and expression profiling of NKG2D ligands in a wide spectrum of human epithelial neoplasms.
25291178 2014 Autonomous stimulation of cancer cell plasticity by the human NKG2D lymphocyte receptor coexpressed with its ligands on cancer cells.
25286418 2014 Expansion of NK cells and reduction of NKG2D expression in chronic lymphocytic leukemia. Correlation with progressive disease.
25258323 2014 The selenium metabolite methylselenol regulates the expression of ligands that trigger immune activation through the lymphocyte receptor NKG2D.
25203601 2014 Polymorphisms in genes coding for the NK-cell receptor NKG2D and its ligand MICA in recurrent miscarriage.
25136121 2014 Immune evasion mediated by tumor-derived lactate dehydrogenase induction of NKG2D ligands on myeloid cells in glioblastoma patients.
25092887 2014 A truncated human NKG2D splice isoform negatively regulates NKG2D-mediated function.
24891320 2014 Transcription of the activating receptor NKG2D in natural killer cells is regulated by STAT3 tyrosine phosphorylation.
24846123 2014 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
24841552 2014 Corticotropin-releasing factor induces immune escape of cervical cancer cells by downregulation of NKG2D.
24803550 2014 L-plastin is involved in NKG2D recruitment into lipid rafts and NKG2D-mediated NK cell migration.
24777763 2014 NK cells are primed by ANRS MVA(HIV)-infected DCs, via a mechanism involving NKG2D and membrane-bound IL-15, to control HIV-1 infection in CD4+ T cells.
24769842 2014 Decreased expression of NKG2D, NKp46, DNAM-1 receptors, and intracellular perforin and STAT-1 effector molecules in NK cells and their dim and bright subsets in metastatic melanoma patients.
24718859 2014 Immunological visibility: posttranscriptional regulation of human NKG2D ligands by the EGF receptor pathway.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24496997 2014 XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells.
24282598 2013 CD4+NKG2D+ T cells exhibit enhanced migratory and encephalitogenic properties in neuroinflammation.
24203492 2015 The narrow-spectrum HDAC inhibitor entinostat enhances NKG2D expression without NK cell toxicity, leading to enhanced recognition of cancer cells.
24168855 2014 NKG2D- and CD28-mediated costimulation regulate CD8+ T cell chemotaxis through different mechanisms: the role of Cdc42/N-WASp.
24141776 2014 Effects on tumor development and metastatic dissemination by the NKG2D lymphocyte receptor expressed on cancer cells.
24019170 2013 NKG2D regulates production of soluble TRAIL by ex vivo expanded human ?? T cells.
23994587 2013 Soluble MICA-NKG2D interaction upregulates IFN-? production by activated CD3-CD56+ NK cells: potential impact on chronic graft versus host disease.
23947399 2013 Substantial increase in the frequency of circulating CD4+NKG2D+ T cells in patients with cervical intraepithelial neoplasia grade 1.
23945543 2014 Oligoclonal expansions of mucosal T cells in Crohn's disease predominate in NKG2D-expressing CD4 T cells.
23913973 2013 Immunobiology and conflicting roles of the human NKG2D lymphocyte receptor and its ligands in cancer.
23846901 2013 Mg2+ regulates cytotoxic functions of NK and CD8 T cells in chronic EBV infection through NKG2D.
23772752 2013 A GPI anchor explains the unique biological features of the common NKG2D-ligand allele MICA*008.
23696226 2013 CEACAM1 on activated NK cells inhibits NKG2D-mediated cytolytic function and signaling.
23445485 2013 Ataxia-telangiectasia mutated kinase-mediated upregulation of NKG2D ligands on leukemia cells by resveratrol results in enhanced natural killer cell susceptibility.
23417963 2013 NKG2D stimulated T-cell autoreactivity in giant cell arteritis and polymyalgia rheumatica.
23413900 2013 Role of the crosstalk between CTLA-4 and NKG2D in the development of anti-CTLA-4 treatment strategies.
23360454 2013 Differential expression of natural killer cell activating receptors in blood versus bone marrow in patients with monoclonal gammopathy.
23302231 2013 A chimeric receptor with NKG2D specificity enhances natural killer cell activation and killing of tumor cells.
23298273 2013 Aberrantly decreased levels of NKG2D expression in children with kawasaki disease.
23298206 2013 Regulation of ligands for the NKG2D activating receptor.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23235109 2013 DNA demethylation and histone H3K9 acetylation determine the active transcription of the NKG2D gene in human CD8+ T and NK cells.
23115291 2013 Crystal structure of the cowpox virus-encoded NKG2D ligand OMCP.
23020627 2012 Immune protection function of multipotent mesenchymal stromal cells: role of transforming growth factor-?1.
22942430 2012 Negative regulation of NKG2D expression by IL-4 in memory CD8 T cells.
22870231 2012 Regulation and gene expression profiling of NKG2D positive human cytomegalovirus-primed CD4+ T-cells.
22806577 2013 Simultaneous knockdown of multiple ligands of innate receptor NKG2D prevents natural killer cell-mediated fulminant hepatitis in mice.
22798674 2012 Ras activation induces expression of Raet1 family NK receptor ligands.
22730533 2012 Comprehensive analysis of NKG2D ligand expression and release in leukemia: implications for NKG2D-mediated NK cell responses.
22715368 2012 Effect of recombinant cytokines on the expression of natural killer cell receptors from patients with TB or/and HIV infection.
22640649 Expression of NKG2D and CD107 in CD8(+) effector memory lymphocytes in Churg-Strauss syndrome.
22613008 Importance of NKG2D-NKG2D ligands interaction for cytolytic activity of natural killer cell.
22585739 2012 Wiskott-Aldrich syndrome protein (WASp) and N-WASp are involved in the regulation of NK-cell migration upon NKG2D activation.
22555808 2012 Role of NKG2D in cytokine-induced killer cells against multiple myeloma cells.
22507622 2012 Effects of NKG2D haplotypes on the cell-surface expression of NKG2D protein on natural killer and CD8 T cells of peripheral blood among atomic-bomb survivors.
22480139 2012 Prevalence of the NKG2D Thr72Ala polymorphism in patients with cervical carcinoma.
22449797 2012 NK cells from HCV-infected patients effectively induce apoptosis of activated primary human hepatic stellate cells in a TRAIL-, FasL- and NKG2D-dependent manner.
22438812 2012 TGF-?1 down-regulation of NKG2D/DAP10 and 2B4/SAP expression on human NK cells contributes to HBV persistence.
22384114 2012 Cytotoxicity of CD56(bright) NK cells towards autologous activated CD4+ T cells is mediated through NKG2D, LFA-1 and TRAIL and dampened via CD94/NKG2A.
22360401 2012 Changes in natural killer cell subsets in pediatric liver transplant recipients.
22316211 2012 Cervical cancer cell lines expressing NKG2D-ligands are able to down-modulate the NKG2D receptor on NKL cells with functional implications.
22304689 2012 Histamine reduces susceptibility to natural killer cells via down-regulation of NKG2D ligands on human monocytic leukaemia THP-1 cells.
22252158 2012 Decreased number and reduced NKG2D expression of V?1 ?? T cells are involved in the impaired function of V?1 ?? T cells in the tissue of gastric cancer.
22242197 2012 Dynamic shift from CD85j/ILT-2 to NKG2D NK receptor expression pattern on human decidual NK during the first trimester of pregnancy.
22200673 2012 Possible association of decreased NKG2D expression levels and suppression of the activity of natural killer cells in patients with colorectal cancer.
22170554 2012 Possible implication of NFKB1A and NKG2D genes in susceptibility to HTLV-1-associated myelopathy/tropical spastic paraparesis in Peruvian patients infected with HTLV-1.
22167753 2012 High ERp5/ADAM10 expression in lymph node microenvironment and impaired NKG2D ligands recognition in Hodgkin lymphomas.
22143889 2011 CEACAM1 dampens antitumor immunity by down-regulating NKG2D ligand expression on tumor cells.
22105417 2012 Decreased NKp46 and NKG2D and elevated PD-1 are associated with altered NK-cell function in pediatric transplant patients with PTLD.
22104546 2011 Immune activation resulting from NKG2D/ligand interaction promotes atherosclerosis.
22102694 2012 Tumor suppressive microRNAs miR-34a/c control cancer cell expression of ULBP2, a stress-induced ligand of the natural killer cell receptor NKG2D.
21898152 2011 Regulation of immune cell function and differentiation by the NKG2D receptor.
21816829 2011 Complex regulation of human NKG2D-DAP10 cell surface expression: opposing roles of the ?c cytokines and TGF-?1.
21789015 A possible mechanism of impaired NK cytotoxicity in cancer patients: down-regulation of DAP10 by TGF-beta1.
21712812 2011 A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans.
21706044 2011 HMBOX1 negatively regulates NK cell functions by suppressing the NKG2D/DAP10 signaling pathway.
21689246 Treatment of alopecia areata: "What is new on the horizon?".
21626292 2012 Decreased NKG2D expression on NK cells correlates with impaired NK cell function in patients with gastric cancer.
21600899 2011 Activation of the receptor NKG2D leads to production of Th17 cytokines in CD4+ T cells of patients with Crohn's disease.
21598106 2012 Prevalence of the NKG2D Thr72Ala polymorphism in patients with systemic lupus erythematosus.
21590763 2011 NKG2D performs two functions in invariant NKT cells: direct TCR-independent activation of NK-like cytolysis and co-stimulation of activation by CD1d.
21554925 2011 T cells expressing the activating NK-cell receptors KIR2DS4, NKG2C and NKG2D are elevated in paroxysmal nocturnal hemoglobinuria and cytotoxic toward hematopoietic progenitor cell lines.
21518928 2011 NKG2D receptor regulates human effector T-cell cytokine production.
21518478 2011 [Expression of NKG2D and NKG2A with their ligands MHC-I A/B and HLA-E in acute leukemia patients and its significance].
21477352 2011 Expression of MICA, MICB and NKG2D in human leukemic myelomonocytic and cervical cancer cells.
21469127 2011 Role of NKG2D and its ligands in the anti-infectious activity of V?9V?2 T cells against intracellular bacteria.
21321202 2011 Expression, signaling proficiency, and stimulatory function of the NKG2D lymphocyte receptor in human cancer cells.
21307295 2011 Cutting edge: CD8+ T cell priming in the absence of NK cells leads to enhanced memory responses.
21277902 2011 IDO metabolite produced by EBV-transformed B cells inhibits surface expression of NKG2D in NK cells via the c-Jun N-terminal kinase (JNK) pathway.
21179506 2010 Matched sizes of activating and inhibitory receptor/ligand pairs are required for optimal signal integration by human natural killer cells.
21115900 2010 The antitumour effect of {gamma}{delta} T-cells is enhanced by valproic acid-induced up-regulation of NKG2D ligands.
21085608 2010 Hepatitis C virus (HCV) evades NKG2D-dependent NK cell responses through NS5A-mediated imbalance of inflammatory cytokines.
21074271 2011 Systematic mutation and thermodynamic analysis of central tyrosine pairs in polyspecific NKG2D receptor interactions.
21061445 2010 IL-2-activated haploidentical NK cells restore NKG2D-mediated NK-cell cytotoxicity in neuroblastoma patients by scavenging of plasma MICA.
20959069 2010 [Expression and clinical significance of CD8+natural killer T cell stimulatory receptor NKG2D in peripheral blood of lung cancer patients].
20926796 2010 NKG2D initiates caspase-mediated CD3zeta degradation and lymphocyte receptor impairments associated with human cancer and autoimmune disease.
20883317 2010 Interleukin-10 promotes NK cell killing of autologous macrophages by stimulating expression of NKG2D ligands.
20863413 2010 Cytotoxic T cells expressing the co-stimulatory receptor NKG2 D are increased in cigarette smoking and COPD.
20844584 2010 Functional dichotomy between NKG2D and CD28-mediated co-stimulation in human CD8+ T cells.
20800424 2010 Novel aspects of in vitro IL-2 or IFN-? enhanced NK cytotoxicity of healthy individuals based on NKG2D and CD161 NK cell receptor induction.
20648603 2010 Association of NKG2D genetic polymorphism with susceptibility to chronic hepatitis B in a Han Chinese population.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20536569 2010 Effect of NKG2D ligand expression on host immune responses.
20530257 2010 Intact NKG2D-independent function of NK cells chronically stimulated with the NKG2D ligand Rae-1.
20519648 2010 Cutting edge: FcR-like 5 on innate B cells is targeted by a poxvirus MHC class I-like immunoevasin.
20511557 2010 NKG2D costimulates human V gamma 9V delta 2 T cell antitumor cytotoxicity through protein kinase C theta-dependent modulation of early TCR-induced calcium and transduction signals.
20488792 2010 Multiple mechanisms downstream of TLR-4 stimulation allow expression of NKG2D ligands to facilitate macrophage/NK cell crosstalk.
20460636 2010 MICA polymorphism identified by whole genome array associated with NKG2D-mediated cytotoxicity in T-cell large granular lymphocyte leukemia.
20415540 2010 Expression of heat shock protein 70 and NKG2D ligands in acute myeloid leukemia cell lines.
20393128 2010 Inhibition of NKG2D expression in NK cells by cytokines secreted in response to human cytomegalovirus infection.
20354827 2011 Clinical significance of the immunostimulatory MHC class I chain-related molecule A and NKG2D receptor on NK cells in pancreatic cancer.
20150362 2010 TGF-beta downregulates the activating receptor NKG2D on NK cells and CD8+ T cells in glioma patients.
20080967 2010 Differential mechanisms of shedding of the glycosylphosphatidylinositol (GPI)-anchored NKG2D ligands.
20074451 Decrease in phosphorylation of ERK following decreased expression of NK cell-activating receptors in human NK cell line exposed to asbestos.
20045334 2010 The soluble major histocompatibility complex class I-related chain A protein reduced NKG2D expression on natural killer and T cells from patients with prolactinoma and non-secreting pituitary adenoma.
20024547 2010 Reduced immune effector cell NKG2D expression and increased levels of soluble NKG2D ligands in multiple myeloma may not be causally linked.
20012119 2010 Assay of T- and NK-cell subsets and the expression of NKG2A and NKG2D in patients with new-onset systemic lupus erythematosus.
20008788 2010 HIV-1 Vpr up-regulates expression of ligands for the activating NKG2D receptor and promotes NK cell-mediated killing.
19861434 2009 NKG2D ligand expression in human colorectal cancer reveals associations with prognosis and evidence for immunoediting.
19794085 2009 NKG2D gene polymorphism has a significant impact on transplant outcomes after HLA-fully-matched unrelated bone marrow transplantation for standard risk hematologic malignancies.
19735685 2010 Association of an NKG2D gene variant with systemic lupus erythematosus in two populations.
19711124 2009 Distribution of several activating and inhibitory receptors on CD3-CD16+ NK cells and their correlation with NK cell function in healthy individuals.
19689730 2009 An integrated view of the regulation of NKG2D ligands.
19658097 2009 ULBP6/RAET1L is an additional human NKG2D ligand.
19631280 2009 NKG2D and its ligands.
19587005 2009 NKG2D-dependent IL-17 production by human T cells in response to an intracellular pathogen.
19569244 2009 Down-regulation of HLA Class I and NKG2D ligands through a concerted action of MAPK and DNA methyltransferases in colorectal cancer cells.
19555665 2009 NKG2D and CD94 bind to heparin and sulfate-containing polysaccharides.
19542445 2009 Human placenta expresses and secretes NKG2D ligands via exosomes that down-modulate the cognate receptor expression: evidence for immunosuppressive function.
19508374 2009 Herpes simplex virus infection downmodulates NKG2D ligand expression.
19498463 2009 Tumour-experienced T cells promote NK cell activity through trogocytosis of NKG2D and NKp46 ligands.
19489688 2009 Biomarkers of suppressed natural killer (NK) cell function in metastatic melanoma: decreased NKG2D and increased CD158a receptors on CD3-CD16+ NK cells.
19454690 2009 PI3K links NKG2D signaling to a CrkL pathway involved in natural killer cell adhesion, polarity, and granule secretion.
19436053 2009 The NKG2D ligand ULBP4 binds to TCRgamma9/delta2 and induces cytotoxicity to tumor cells through both TCRgammadelta and NKG2D.
19424970 2009 Differential NKG2D binding to highly related human NKG2D ligands ULBP2 and RAET1G is determined by a single amino acid in the alpha2 domain.
19363685 2009 MICA polymorphisms and decreased expression of the MICA receptor NKG2D contribute to idiopathic pulmonary fibrosis susceptibility.
19329438 2009 The traffic of the NKG2D/Dap10 receptor complex during natural killer (NK) cell activation.
19319200 2009 Dendritic cell-derived exosomes promote natural killer cell activation and proliferation: a role for NKG2D ligands and IL-15Ralpha.
19303396 2009 NKG2D and CD94 bind to multimeric alpha2,3-linked N-acetylneuraminic acid.
19289577 2009 Normally occurring NKG2D+CD4+ T cells are immunosuppressive and inversely correlated with disease activity in juvenile-onset lupus.
19286259 2009 The role of the activating receptor NKG2D in autoimmunity.
19237603 2009 Cytosolic PLA2 is required for CTL-mediated immunopathology of celiac disease via NKG2D and IL-15.
19200602 2009 Mutual activation of CD4+ T cells and monocytes mediated by NKG2D-MIC interaction requires IFN-gamma production in systemic lupus erythematosus.
19155520 2009 Oxidative stress mediates a reduced expression of the activating receptor NKG2D in NK cells from end-stage renal disease patients.
19140827 2009 A study of natural killer cell lectin-like receptor K1 gene (KLRK1/NKG2D) region polymorphisms in a European population sample.
19124832 2009 Detuning CD8+ T lymphocytes by down-regulation of the activating receptor NKG2D: role of NKG2D ligands released by activated T cells.
19118515 2008 Hepatitis C virus infection downregulates the ligands of the activating receptor NKG2D.
19087227 2008 The expression and function of NKG2D molecule on intrahepatic CD8+ T cells in chronic viral hepatitis.
19086992 2009 Human uterine NK cells interact with uterine macrophages via NKG2D upon stimulation with PAMPs.
19038287 2009 Re-organization of mitochondria at the NK cell immune synapse.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
18941207 2008 Human NK cells kill resting but not activated microglia via NKG2D- and NKp46-mediated recognition.
18836475 2008 NKG2D ligands in tumor immunity.
18832705 2008 NKG2D is critical for NK cell activation in host defense against Pseudomonas aeruginosa respiratory infection.
18754036 2009 NKG2D ligands expression and NKG2D-mediated NK activity in Sezary patients.
18700876 2008 Inhibitory NKG2A and activating NKG2D and NKG2C natural killer cell receptor genes: susceptibility for rheumatoid arthritis.
18676862 2008 Tumor-associated MICA is shed by ADAM proteases.
18658158 2008 Natural-killer cell ligands at the maternal-fetal interface: UL-16 binding proteins, MHC class-I chain related molecules, HLA-F and CD48.
18657862 2008 NK cells recognize and lyse Ewing sarcoma cells through NKG2D and DNAM-1 receptor dependent pathways.
18619507 2008 Interleukin-12 improves cytotoxicity of natural killer cells via upregulated expression of NKG2D.
18602338 2008 NKG2D ligands: key targets of the immune response.
18599182 2008 Chimeric NKG2D receptor-expressing T cells as an immunotherapy for multiple myeloma.
18564160 2009 Inverse correlation between NKG2D expression on CD8+ T cells and the frequency of CD4+CD25+ regulatory T cells in patients with esophageal cancer.
18508446 2008 Soluble NKG2D ligands: prevalence, release, and functional impact.
18490733 2008 Macrophage migration inhibitory factor contributes to the immune escape of ovarian cancer by down-regulating NKG2D.
18490724 2008 Human tumor-derived exosomes down-modulate NKG2D expression.
18417514 2008 NKG2D-dependent effector function of bronchial epithelium-activated alloreactive T-cells.
18398831 2008 Opposite impact of NKG2D genotype by lifestyle exposure to risk of aerodigestive tract cancer among Japanese.
18398827 2008 Investigation of cholangiocarcinoma associated NKG2D polymorphisms in colorectal carcinoma.
18394936 2008 NKG2D-deficient mice are defective in tumor surveillance in models of spontaneous malignancy.
18361934 2008 Evaluation of functional single nucleotide polymorphisms of different genes coding for the immunoregulatory molecules in patients with monoclonal large granular lymphocyte lymphocytosis.
18360276 2008 Induction of NKG2D ligands by gamma radiation and tumor necrosis factor-alpha may participate in the tissue damage during acute graft-versus-host disease.
18354183 2008 Intracellular retention of the NKG2D ligand MHC class I chain-related gene A in human melanomas confers immune privilege and prevents NK cell-mediated cytotoxicity.
18316620 2008 Selective induction of expression of a ligand for the NKG2D receptor by proteasome inhibitors.
18313361 2008 Expansion of circulating NKG2D+ effector memory T-cells and expression of NKG2D-ligand MIC in granulomaous lesions in Wegener's granulomatosis.
18287244 2008 Adenovirus E3/19K promotes evasion of NK cell recognition by intracellular sequestration of the NKG2D ligands major histocompatibility complex class I chain-related proteins A and B.
18280748 2008 Interleukin-15 improves cytotoxicity of natural killer cells via up-regulating NKG2D and cytotoxic effector molecule expression as well as STAT1 and ERK1/2 phosphorylation.
18275895 2008 Up-regulation of NK cell activating receptors following allogeneic hematopoietic stem cell transplantation under a lymphodepleting reduced intensity regimen is associated with elevated IL-15 levels.
18230726 2008 Down-regulation of NKG2D and NKp80 ligands by Kaposi's sarcoma-associated herpesvirus K5 protects against NK cell cytotoxicity.
18202175 2008 MHC class I chain-related protein A antibodies and shedding are associated with the progression of multiple myeloma.
18174257 2008 Decreased risk of colorectal cancer with the high natural killer cell activity NKG2D genotype in Japanese.
18097042 2008 Regulation of human DAP10 gene expression in NK and T cells by Ap-1 transcription factors.
18094430 2007 NKG2D-mediated antitumor activity by tumor-infiltrating lymphocytes and antigen-specific T-cell clones isolated from melanoma patients.
18094399 2007 The requirements for CTL-mediated rejection of cancer in humans: NKG2D and its role in the immune responsiveness of melanoma.
18070447 2007 [Expression of membrane/soluble MHC class I chain-related molecule A and NKG2D receptor in osteosarcoma and its clinical significance].
18024793 2008 4-1BB regulates NKG2D costimulation in human cord blood CD8+ T cells.
18023027 2008 Cholangiocarcinoma in primary sclerosing cholangitis is associated with NKG2D polymorphisms.
18006849 2007 Chimeric NKG2D modified T cells inhibit systemic T-cell lymphoma growth in a manner involving multiple cytokines and cytotoxic pathways.
17991774 2007 Blockade of NKG2D on NKT cells prevents hepatitis and the acute immune response to hepatitis B virus.
17923698 2007 Phosphatidylinositol 3-kinase activation is required to form the NKG2D immunological synapse.
17875681 2007 The requirement for DNAM-1, NKG2D, and NKp46 in the natural killer cell-mediated killing of myeloma cells.
17661204 2007 Comparison of level of NKG2D ligands between normal and tumor tissue using multiplex RT-PCR.
17635809 Lysis of a broad range of epithelial tumour cells by human gamma delta T cells: involvement of NKG2D ligands and T-cell receptor- versus NKG2D-dependent recognition.
17625602 2007 Regulation of the expression of MHC class I-related chain A, B (MICA, MICB) via chromatin remodeling and its impact on the susceptibility of leukemic cells to the cytotoxicity of NKG2D-expressing cells.
17609265 2007 Human T-cell leukemia virus type 1 (HTLV-1) p12I down-modulates ICAM-1 and -2 and reduces adherence of natural killer cells, thereby protecting HTLV-1-infected primary CD4+ T cells from autologous natural killer cell-mediated cytotoxicity despite the reduction of major histocompatibility complex class I molecules on infected cells.
17584663 2007 [Expression of NKG2D ligands in multidrug-resistant nasopharyngeal carcinoma cell line CNE2/DDP and their effects on cytotoxicity of natural killer cells].
17570210 2007 CD4+NKG2D+ T cells in Crohn's disease mediate inflammatory and cytotoxic responses through MICA interactions.
17470428 2007 RAET1E2, a soluble isoform of the UL16-binding protein RAET1E produced by tumor cells, inhibits NKG2D-mediated NK cytotoxicity.
17405908 2007 Antigen-activated human T lymphocytes express cell-surface NKG2D ligands via an ATM/ATR-dependent mechanism and become susceptible to autologous NK- cell lysis.
17267578 2007 NKG2D-mediated cytotoxicity toward oligodendrocytes suggests a mechanism for tissue injury in multiple sclerosis.
17255258 2007 Decreased NKG2D expression on CD8+ T cell is involved in immune evasion in patients with gastric cancer.
17217747 2006 [The relationship of nature killer cell 2D gene polymorphisms and ulcerative colitis in the Chinese].
17202358 2007 Promoter region architecture and transcriptional regulation of the genes for the MHC class I-related chain A and B ligands of NKG2D.
17173658 2007 Heightened expression of the cytotoxicity receptor NKG2D correlates with acute and chronic nephropathy after kidney transplantation.
17109473 2006 Expression and function of NKG2D in CD4+ T cells specific for human cytomegalovirus.
17043026 2006 The effect of silencing NKG2D through RNA interference on receptor functions in interleukin-2-activated human natural killer cells.
16914326 2006 The role of the NKG2D receptor for tumor immunity.
16901903 2006 Transcriptional regulation of ULBP1, a human ligand of the NKG2D receptor.
16887974 2006 Porcine UL16-binding protein 1 expressed on the surface of endothelial cells triggers human NK cytotoxicity through NKG2D.
16849432 2006 Transfer of NKG2D and MICB at the cytotoxic NK cell immune synapse correlates with a reduction in NK cell cytotoxic function.
16732291 2006 Fas-ligand-mediated paracrine T cell regulation by the receptor NKG2D in tumor immunity.
16690951 2006 Human congenital infection with Trypanosoma cruzi induces phenotypic and functional modifications of cord blood NK cells.
16630603 2006 Soluble ULBP suppresses natural killer cell activity via down-regulating NKG2D expression.
16568261 2006 Immunostimulation by induced expression of NKG2D and its MIC ligands in HTLV-1-associated neurologic disease.
16541075 2006 The finished DNA sequence of human chromosome 12.
16517727 2006 Placenta-derived soluble MHC class I chain-related molecules down-regulate NKG2D receptor on peripheral blood mononuclear cells during human pregnancy: a possible novel immune escape mechanism for fetal survival.
16444266 2006 Interferon-producing killer dendritic cells provide a link between innate and adaptive immunity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293707 2006 Expression of toll-like receptors by human muscle cells in vitro and in vivo: TLR3 is highly expressed in inflammatory and HIV myopathies, mediates IL-8 release and up-regulation of NKG2D-ligands.
16272287 2005 Interaction between human NK cells and bone marrow stromal cells induces NK cell triggering: role of NKp30 and NKG2D receptors.
16239914 2005 TNFalpha stimulates NKG2D-mediated lytic activity of acute myeloid leukemic cells.
16210654 2005 Human NK cytotoxicity against porcine cells is triggered by NKp44 and NKG2D.
16136475 2005 Interleukin-15 activates human natural killer cells to clear the intestinal protozoan cryptosporidium.
16081780 2005 Activation of V gamma 9V delta 2 T cells by NKG2D.
15894612 2005 The activating NKG2D receptor assembles in the membrane with two signaling dimers into a hexameric structure.
15885603 Exosomes and the MICA-NKG2D system in cancer.
15814668 2005 NKG2D is a costimulatory receptor for human naive CD8+ T cells.
15699512 2004 Killer cell immunoglobulin-like receptor genes in Latvian patients with type 1 diabetes mellitus and healthy controls.
15699119 2005 Engagement of NKG2D by cognate ligand or antibody alone is insufficient to mediate costimulation of human and mouse CD8+ T cells.
15657183 2005 Ligands for natural killer cell-activating receptors are expressed upon the maturation of normal myelomonocytic cells but at low levels in acute myeloid leukemias.
15652646 2005 The inhibitory effects of synthetic short peptides, mimicking MICA and targeting at NKG2D receptors, on function of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328155 2005 HLA class I, NKG2D, and natural cytotoxicity receptors regulate multiple myeloma cell recognition by natural killer cells.
15294961 2004 A Structural basis for the association of DAP12 with mouse, but not human, NKG2D.
15240696 2004 Two human ULBP/RAET1 molecules with transmembrane regions are ligands for NKG2D.
15187109 2004 Elevated TGF-beta1 secretion and down-modulation of NKG2D underlies impaired NK cytotoxicity in cancer patients.
15070686 2004 Role of NKG2D signaling in the cytotoxicity of activated and expanded CD8+ T cells.
15065764 NKG2D.
15051759 2004 Cell surface organization of stress-inducible proteins ULBP and MICA that stimulate human NK cells and T cells via NKG2D.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14523385 2003 Roles of the NKG2D immunoreceptor and its ligands.
14508119 Letal, A tumor-associated NKG2D immunoreceptor ligand, induces activation and expansion of effector immune cells.
12902493 2003 Potential role of NKG2D/MHC class I-related chain A interaction in intrathymic maturation of single-positive CD8 T cells.
12740575 2003 NKG2D-DAP10 triggers human NK cell-mediated killing via a Syk-independent regulatory pathway.
12732206 2003 ULBP4 is a novel ligand for human NKG2D.
12679019 2003 Symmetry recognizing asymmetry: analysis of the interactions between the C-type lectin-like immunoreceptor NKG2D and MHC class I-like ligands.
12646700 2003 Transforming growth factor beta 1 inhibits expression of NKp30 and NKG2D receptors: consequences for the NK-mediated killing of dendritic cells.
12594848 2003 Selective intracellular retention of virally induced NKG2D ligands by the human cytomegalovirus UL16 glycoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426565 2002 Selective associations with signaling proteins determine stimulatory versus costimulatory activity of NKG2D.
12426564 2002 NKG2D recruits two distinct adapters to trigger NK cell activation and costimulation.
12384702 2002 Tumour-derived soluble MIC ligands impair expression of NKG2D and T-cell activation.
12133964 2002 Structural studies of allelic diversity of the MHC class I homolog MIC-B, a stress-inducible ligand for the activating immunoreceptor NKG2D.
11973127 2002 Lymphocyte activation via NKG2D: towards a new paradigm in immune recognition?
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11754823 2001 Conformational plasticity revealed by the cocrystal structure of NKG2D and its class I MHC-like ligand ULBP3.
11751968 2002 Conservation and variation in human and common chimpanzee CD94 and NKG2 genes.
11567106 2001 Regulation of cutaneous malignancy by gammadelta T cells.
11520456 2001 Molecular competition for NKG2D: H60 and RAE1 compete unequally for NKG2D with dominance of H60.
11323699 2001 Complex structure of the activating immunoreceptor NKG2D and its MHC class I-like ligand MICA.
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.
11224526 2001 Costimulation of CD8alphabeta T cells by NKG2D via engagement by MIC induced on virus-infected cells.
11015446 2000 DAP10 and DAP12 form distinct, but functionally cooperative, receptor complexes in natural killer cells.
10426994 1999 An activating immunoreceptor complex formed by NKG2D and DAP10.
10426993 1999 Activation of NK cells and T cells by NKG2D, a receptor for stress-inducible MICA.
10367903 1999 Crystal structure of the MHC class I homolog MIC-A, a gammadelta T cell ligand.
9683661 1998 The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex.
9598306 1998 Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes.
9394807 1997 Cloning of NKG2-F, a new member of the NKG2 family of human natural killer cell receptor genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2007850 1991 DNA sequence analysis of NKG2, a family of related cDNA clones encoding type II integral membrane proteins on human natural killer cells.