Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.40
PubTator Score 8.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Gene RIF (7)

PMID Text
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
20811687 NKG2F was expressed on surface of human blood NK cells, and may be up-regulated at mRNA level and protein level after IL-2 or IL-15 stimulation.
20648603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18006695 Observational study of gene-disease association. (HuGE Navigator)
16397273 Observational study of gene-disease association. (HuGE Navigator)
15140575 NKG2F is expressed in NK cells and can associate with DAP12.

AA Sequence

MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRT     71 - 140
WEERVCWPVLRRTLICFL                                                        141 - 158
//

Text Mined References (19)

PMID Year Title
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
23291587 2013 Genome-wide association analysis identifies new susceptibility loci for Behçet's disease and epistasis between HLA-B*51 and ERAP1.
20811687 2010 Up-regulation of NKG2F receptor, a functionally unknown killer receptor, of human natural killer cells by interleukin-2 and interleukin-15.
20654155 2010 [Study on expression of natural killer (NK) cell C-type lectin-like receptors in nasal NK/T-cell lymphomas].
20648603 2010 Association of NKG2D genetic polymorphism with susceptibility to chronic hepatitis B in a Han Chinese population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18006695 2008 Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.
16541075 2006 The finished DNA sequence of human chromosome 12.
16397273 2006 Identification of the NKG2D haplotypes associated with natural cytotoxic activity of peripheral blood lymphocytes and cancer immunosurveillance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140575 2004 Human NKG2F is expressed and can associate with DAP12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11751968 2002 Conservation and variation in human and common chimpanzee CD94 and NKG2 genes.
10783260 2000 A sequence-ready physical map of the region containing the human natural killer gene complex on chromosome 12p12.3-p13.2.
9887346 1999 Linkage of the NKG2 and CD94 receptor genes to D12S77 in the human natural killer gene complex.
9683661 1998 The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex.
9598306 1998 Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes.
9394807 1997 Cloning of NKG2-F, a new member of the NKG2 family of human natural killer cell receptor genes.
8436421 1993 A multigene family on human chromosome 12 encodes natural killer-cell lectins.