Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.85
PubTator Score 7.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Monkeypox 12 4.136 2.1
Dental fluorosis 20 3.432 1.7

Expression

Gene RIF (3)

AA Sequence

MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYDCQGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEEWITYSNSCYYIGKERRTWEE     71 - 140
SLQACASKNSSSLLCIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAML    141 - 210
HVRGLISDQCGSSRIIRRGFIMLTRLVLNS                                            211 - 240
//

Text Mined References (10)

PMID Year Title