Property Summary

NCBI Gene PubMed Count 68
PubMed Score 255.78
PubTator Score 208.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.0e-25

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 2.0e-25

Protein-protein Interaction (1)

Gene RIF (55)

PMID Text
26856773 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26453750 Coengagement of inhibitory receptors, either KIR2DL1 or CD94-NKG2A, did not inhibit phosphorylation of Stat5 but inhibited selectively phosphorylation of Akt and S6 ribosomal protein.
26453102 CD94 and NKG2A polymorphisms may contribute to genetic susceptibility to rheumatoid arthritis or affect the response to anti-TNF therapy in patients of Caucasian origin.
25220367 The presence of TIM3+and/or NKG2A+ T cells is associated with the absence of recurrences and a longer recurrence-free survival.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
22486170 Results suggested that the low expression level of CD94/NKG2A upon gammadelta T cell activation might lead to the over-activation of gammadelta T cells in patients with SLE.
21538351 The level of NKG2A expression on resting CD8-positive T cells inversely correlated with acquisition of regulatory function when activated.
21518478 The positive expression rate of NKG2D and NKG2A on NK cells and CD3(+) T cells in ALL patients was no significantly different from that in AML patients.
21212510 These results suggested that these glycans can interact with NKG2D and CD94 to modulate NK cell-dependent cytotoxicity.
20952657 NKG2A expression on gammadelta lymphoproliferative Disease of Large Granular Lymphocytes correlates with asymptomatic pathology, even in the presence of NKG2C coexpression.
20700504 a new model in which the NK cell differentiation and functional fate are based on a stepwise decrease of NKG2A and acquisition of KIRs
20696944 CD56(dim) NK cells continue to differentiate. During this process, they lose expression of NKG2A, sequentially acquire inhibitory killer cell inhibitory immunoglobulin-like receptors and CD57.
20654155 The differences of CD94 and NKG2 expression between nasal NK/T-cell lymphomas and B cell lymphoma or T cell lymphoma were statistically significant.
20648603 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20550548 NK cell NKG2A expression is dysregulated in chronic hepatitis C. NKG2A-positive NK cells are associated with a beneficial response to pegylated interferon and ribavirin therapy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20139023 alloreactivity of a significant fraction of KIR(-) NK cells leads to killing of acute myelogenous leukemia and acute lymphoblastic leukemia blasts that is mediated by NKG2A and LIR-1.
20012119 increased CD8+ T-cell subsets as well as the abnormal expression of NKG2A and NKG2D on CD3+ T and CD3-CD56 + NK cells may play a role in the etiology of systemic lupus erythematosus
19782712 demonstrate that human cytomegalovirus induces an immediate proportional enlargement of a functionally active CD94/NKG2A expressing subset of natural killer cells.
19694640 Although the percentages of both NKG2A- and NKG2C-positive NK cells were normal in preeclamptic women, the levels of NKG2A and NKG2C on NK cells were significantly up-regulated in these women
19615756 negatively controls decidual NK cell cytotoxicity
19395088 expression by Vdelta2+ T cells is higher in pregnant women
19124726 Under the influence of interleukin-12 stimulation, CD94/NKG2A is transiently inducible in natural killer (NK) cells bearing the homologous CD94/NKG2C-activating receptor,providing a potential negative regulatory feedback mechanism.
19002424 Data suggest that RNAi-mediated silencing of NKG2A in effector cells could improve the efficacy of cell-based immunotherapies but also show that indirect effects of NKG2A knockdown exist.
18981088 MICA-NKG2D interaction constitutes a mechanism by which monocytes and NK cells as an early source of IFN-gamma may communicate directly during an innate immune response to infections in humans.
18941190 NKG2A expression is inversely correlated with the number of coexpressed killer inhibitory receptors (KIR) and is more frequent on KIR3DL2-single positive natural killer cells.
18700876 No significance was observed between the inhibitory (NKG2A) or activating (NKG2C and NKG2D) receptor genotypes and the presence of RF, ANA, or bony erosions in Rheumatoid arthritis.
18700876 Observational study of gene-disease association. (HuGE Navigator)
18500933 T cells were highly susceptible to NKG2A-mediated inhibition of cytotoxic activity and NKG2A(+) lymphocytes were preferentially attracted by CCR5 ligands induced by hepatitis C virus E2 antigen.
18448674 The evolution of the NKG2x/CD94 family of receptors has likely been shaped both by the need to bind the invariant HLA-E ligand and the need to avoid subversion by pathogen-derived decoys.
18332182 crystal structure of CD94-NKG2A in complex with HLA-E bound to a peptide derived from the leader sequence of HLA-G
18172398 HIV-1 infection is associated with higher levels NKG2A in the cytotoxic NK subset in HIV-1-infected patients with more advanced disease.
18083576 the invariant CD94 chain plays a more dominant role in interacting with HLA-E in comparison to the variable NKG2 chain.
18056444 High levels of NKG2A is associated with tongue cancer
17976318 The results indicated that the high expression of NKG2A/CD94 and low expression of granzyme B may be related with the reduced activity of cord blood NK cells.
17927829 We show that signalling through NKG2A suppresses TH2 effector function. This may provide a means to modulate Th1/Th2 balance in diseases where Th2 cytokines predominate.
17767552 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17767552 indicate that the SNPs of the inhibitory receptor CD94/NKG2A and its haplotypes, as well as its ligand HLA-E, are associated with Behcet's disease immune systems
17706207 Increased expression of CD94/NKG2A in peritoneal NK cells may mediate the resistance of endometriotic tissue to NK cell-mediated lysis, thus contributing to the progression of the disease.
17545086 Results sugges that KLRC1 can be a probable candidate gene for SLE on 12p12.3-13.2, but which is not associated with the disease activity.
17545086 Observational study of gene-disease association. (HuGE Navigator)
16951318 Prevents actin-dependent recruitment of raft-associated activation receptors complexes to the activating immunologic synapse.
16690409 identified co-induction of NKG2A and CD56 on activation of TH2 cells
16434388 only a subpopulation of NK cells expressing high levels of the inhibitory receptor NKG2A are able to lyse autologous vaccinia-infected targets, and that this is due to selective down-regulation of HLA-E
15687235 immaturity of NK cells and inhibitory effect of NKG2A override graft versus leukemia effect
15561299 Expression of the inhibitory NKR (CD94/NKG2A) of the G-CSF mobilized peripheral blood mononuclear cells.
15550116 reveal strict gene regulatory mechanisms for CD94 and NKG2 gene expression on CD4+ cells
15528343 Aberrant expression of natural killer (NK) receptors NKG2A/CD94 may have an impact on the magnitude and direction of dendritic cell activation of T cells under pathological conditions, such as chronic hepatitis C virus infection.
12618865 Observational study of gene-disease association. (HuGE Navigator)
12461076 CD94/NKG2A+ NK cells can recognize stressed cells in a peptide-dependent manner.
12444112 NK cell CD94/NKG2A inhibitory receptors are internalized and recycle independently of inhibitory signaling processes.
12387742 TCR antigenic specificity dictates NKG2A commitment, which critically regulates subsequent activation of CTL.
12165520 Role that each NKG2A immunoreceptor tyrosine-based inhibitory motif plays in mediating the human CD94/NKG2A inhibitory signal.

AA Sequence

MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK      1 - 70
LIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTW     71 - 140
EESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAV    141 - 210
LQVNRLKSAQCGSSIIYHCKHKL                                                   211 - 233
//

Text Mined References (69)

PMID Year Title
26856773 2016 NK cell maturation to CD56(dim) subset associated with high levels of NCRs overrides the inhibitory effect of NKG2A and recovers impaired NK cell cytolytic potential after allogeneic hematopoietic stem cell transplantation.
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
26453102 2016 Influence of CD94 and NKG2A variants on susceptibility to rheumatoid arthritis and efficacy of anti-TNF treatment.
25416956 2014 A proteome-scale map of the human interactome network.
25220367 2015 Expression of coinhibitory receptors on T cells in the microenvironment of usual vulvar intraepithelial neoplasia is related to proinflammatory effector T cells and an increased recurrence-free survival.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
22486170 2012 Downregulation of CD94/NKG2A inhibitory receptor on decreased ?? T cells in patients with systemic lupus erythematosus.
21538351 2011 NKG2A is a marker for acquisition of regulatory function by human CD8+ T cells activated with anti-CD3 antibody.
21518478 2011 [Expression of NKG2D and NKG2A with their ligands MHC-I A/B and HLA-E in acute leukemia patients and its significance].
21212510 2011 Binding affinities of NKG2D and CD94 to sialyl Lewis X-expressing N-glycans and heparin.
20952657 2011 NKG2A inhibits NKG2C effector functions of ?? T cells: implications in health and disease.
20700504 2010 NK cell terminal differentiation: correlated stepwise decrease of NKG2A and acquisition of KIRs.
20696944 2010 Expression patterns of NKG2A, KIR, and CD57 define a process of CD56dim NK-cell differentiation uncoupled from NK-cell education.
20654155 2010 [Study on expression of natural killer (NK) cell C-type lectin-like receptors in nasal NK/T-cell lymphomas].
20648603 2010 Association of NKG2D genetic polymorphism with susceptibility to chronic hepatitis B in a Han Chinese population.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20550548 2010 Association of NKG2A with treatment for chronic hepatitis C virus infection.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20139023 2010 Natural killer cell killing of acute myelogenous leukemia and acute lymphoblastic leukemia blasts by killer cell immunoglobulin-like receptor-negative natural killer cells after NKG2A and LIR-1 blockade.
20012119 2010 Assay of T- and NK-cell subsets and the expression of NKG2A and NKG2D in patients with new-onset systemic lupus erythematosus.
19782712 2010 Short-term exposure to human cytomegalovirus-infected fibroblasts induces a proportional increase of active CD94/NKG2A(+) natural killer cells.
19694640 2009 Women with pre-eclampsia have an altered NKG2A and NKG2C receptor expression on peripheral blood natural killer cells.
19615756 2009 Effector functions of human decidual NK cells in healthy early pregnancy are dependent on the specific engagement of natural cytotoxicity receptors.
19395088 2009 Immunoactivation in preeclampsia: Vdelta2+ and regulatory T cells during the inflammatory stage of disease.
19124726 2009 IL-12-dependent inducible expression of the CD94/NKG2A inhibitory receptor regulates CD94/NKG2C+ NK cell function.
19002424 2009 Permanent silencing of NKG2A expression for cell-based therapeutics.
18981088 2008 Interaction of monocytes with NK cells upon Toll-like receptor-induced expression of the NKG2D ligand MICA.
18941190 2008 Estimation of the size of the alloreactive NK cell repertoire: studies in individuals homozygous for the group A KIR haplotype.
18700876 2008 Inhibitory NKG2A and activating NKG2D and NKG2C natural killer cell receptor genes: susceptibility for rheumatoid arthritis.
18500933 2008 Hepatitis C virus-induced secretion of inflammatory chemokines preferentially recruits NKG2A+CD8+ T cells.
18448674 2008 Structural basis for NKG2A/CD94 recognition of HLA-E.
18332182 2008 CD94-NKG2A recognition of human leukocyte antigen (HLA)-E bound to an HLA class I leader sequence.
18172398 2007 Increased NKG2A found in cytotoxic natural killer subset in HIV-1 patients with advanced clinical status.
18083576 2007 The heterodimeric assembly of the CD94-NKG2 receptor family and implications for human leukocyte antigen-E recognition.
18056444 2007 Differing phenotypes between intraepithelial and stromal lymphocytes in early-stage tongue cancer.
17976318 2007 High expression of NKG2A/CD94 and low expression of granzyme B are associated with reduced cord blood NK cell activity.
17927829 2007 NKG2A inhibits TH2 cell effector function in vitro.
17767552 2007 Association of CD94/NKG2A, CD94/NKG2C, and its ligand HLA-E polymorphisms with Behcet's disease.
17706207 2008 Increased frequency of human leukocyte antigen-E inhibitory receptor CD94/NKG2A-expressing peritoneal natural killer cells in patients with endometriosis.
17545086 2007 [Identification of a novel candidate gene KLRC1 within the putative susceptibility locus for systemic lupus erythematosus at 12p12.3-13.2 in a Chinese cohort].
16951318 2006 CD94/NKG2A inhibits NK cell activation by disrupting the actin network at the immunological synapse.
16690409 2005 NKG2A and CD56 are coexpressed on activated TH2 but not TH1 lymphocytes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16434388 2006 The inhibitory receptor NKG2A determines lysis of vaccinia virus-infected autologous targets by NK cells.
15687235 2005 NK-cell reconstitution after haploidentical hematopoietic stem-cell transplantations: immaturity of NK cells and inhibitory effect of NKG2A override GvL effect.
15561299 2004 Differential expression of natural killer cell receptors (CD94/NKG2A) on T cells by the stimulation of G-CSF-mobilized peripheral blood mononuclear cells with anti-CD3 monoclonal antibody and cytokines: a study in stem cell donors.
15550116 2004 Role for NKG2-A and NKG2-C surface receptors in chronic CD4+ T-cell responses.
15528343 2004 Negative regulation of NK cell activities by inhibitory receptor CD94/NKG2A leads to altered NK cell-induced modulation of dendritic cell functions in chronic hepatitis C virus infection.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12618865 2003 Variations of human killer cell lectin-like receptors: common occurrence of NKG2-C deletion in the general population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461076 2002 A signal peptide derived from hsp60 binds HLA-E and interferes with CD94/NKG2A recognition.
12444112 2002 NK cell CD94/NKG2A inhibitory receptors are internalized and recycle independently of inhibitory signaling processes.
12387742 2002 TCR specificity dictates CD94/NKG2A expression by human CTL.
12165520 2002 Role that each NKG2A immunoreceptor tyrosine-based inhibitory motif plays in mediating the human CD94/NKG2A inhibitory signal.
11513152 2001 Structural basis of MHC class I recognition by natural killer cell receptors.
11238637 2001 The repertoire of killer cell Ig-like receptor and CD94:NKG2A receptors in T cells: clones sharing identical alpha beta TCR rearrangement express highly diverse killer cell Ig-like receptor patterns.
10488737 1999 N-linked oligosaccharides can protect target cells from the lysis mediated by NK cells but not by cytotoxic T lymphocytes: role of NKG2-A.
9842883 1998 Phosphoantigen activation induces surface translocation of intracellular CD94/NKG2A class I receptor on CD94- peripheral Vgamma9 Vdelta2 T cells but not on CD94- thymic or mature gammadelta T cell clones.
9598306 1998 Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes.
9486650 1998 HLA-E binds to natural killer cell receptors CD94/NKG2A, B and C.
9485206 1998 Inhibition of antigen-induced T cell response and antibody-induced NK cell cytotoxicity by NKG2A: association of NKG2A with SHP-1 and SHP-2 protein-tyrosine phosphatases.
9218532 1997 The human natural killer gene complex is located on chromosome 12p12-p13.
9034158 1997 NKG2A complexed with CD94 defines a novel inhibitory natural killer cell receptor.
8943374 1996 Human natural killer cell receptors involved in MHC class I recognition are disulfide-linked heterodimers of CD94 and NKG2 subunits.
8753859 1996 Genomic structure, chromosome location, and alternative splicing of the human NKG2A gene.
8436421 1993 A multigene family on human chromosome 12 encodes natural killer-cell lectins.
2007850 1991 DNA sequence analysis of NKG2, a family of related cDNA clones encoding type II integral membrane proteins on human natural killer cells.