Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.20
PubTator Score 4.64

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.3e-135

Gene RIF (3)

26231762 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival.
25747782 the serum level has the potential to be used as a biomarker for asthma
20424135 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

NGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN                                  211 - 250

Text Mined References (11)

PMID Year Title
26231762 2015 Prognostic significance of multiple kallikreins in high-grade astrocytoma.
25747782 2015 Human tissue kallikrein 9 in asthmatic patients.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11691797 2001 Quantitative expression of the human kallikrein gene 9 (KLK9) in ovarian cancer: a new independent and favorable prognostic marker.
11054574 2000 Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.
10783266 2000 The expanded human kallikrein gene family: locus characterization and molecular cloning of a new member, KLK-L3 (KLK9).
10652563 Identification of novel human kallikrein-like genes on chromosome 19q13.3-q13.4.