Property Summary

NCBI Gene PubMed Count 37
PubMed Score 206.68
PubTator Score 79.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.5e-08
cystic fibrosis 1670 5.9e-04

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.800 5.9e-04
psoriasis 1.600 3.5e-08

Gene RIF (17)

PMID Text
26099606 KLK8 mRNA expression is associated with aggressive tumor characteristics and it can serve as a novel independent biomarker of unfavorable prognosis for BC patients.
25926655 Occurring independently of cyclophilins and of furin that mediate human papillomavirus 16 L2 exposure, KLK8-mediated cleavage of L1 likely facilitated access to L2, located in the capsid lumen, and potentially uncoating.
24614639 It dissects a schizophrenic susceptibility gene, NRG1.
22505524 KLK8 and KLK14 can signal differentially via the PARs to affect tissue function
20940292 KLK8 as a new active serine protease in human stratum corneum and sweat
20614312 The results of this study indicate that most salivary gland tumors show high levels of expression of KLK8.
20424135 Observational study of gene-disease association. (HuGE Navigator)
20360129 The KLK8-T4 alternative splice variant, alone or in combination, may be a new independent marker of unfavorable prognosis in lung cancer.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19125171 The processed end-point enzymes are the same for both type I and type II kallikrein 8, suggesting that the emergence of type II kallikrein 8 in the human brain likely leads to functional modifications of kallikrein 8.
19085836 kallikreins 5, 7, 8, and 10 are abundantly expressed in human OSCC and may be implicated in malignant progression
18354391 Observational study of gene-disease association. (HuGE Navigator)
17487847 analysis of how a mutation leads to the origin of a novel splice form of neuropsin (KLK8), a gene involved in learning and memory
17178872 KLK8 expression confers a favorable clinical outcome in non-small cell lung cancer by suppressing tumor cell invasiveness.
16800733 Amino-terminal sequencing of the activated enzyme demonstrated the cleavage of a 9-aa propeptide from the pro-enzyme; substrate specificiy and effect of metal ions and pH is demonstrated
15138549 Expression of hK8 is increased during the development of ovarian cancer and down-regulated during ovarian cancer progression.
14749636 Cervical cancer expressed high level of TADG-14. May play important role in invasion and metastasis. Appears only in abundance in tumor tissue and contains secretion signal sequence. Possible diagnostic use or as therapeutic target.

AA Sequence

MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT      1 - 70
AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS     71 - 140
LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQG    141 - 210
DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG                        211 - 260
//

Text Mined References (41)

PMID Year Title
26099606 2015 Clinical relevance of the deregulated kallikrein-related peptidase 8 mRNA expression in breast cancer: a novel independent indicator of disease-free survival.
25926655 2015 Kallikrein-8 Proteolytically Processes Human Papillomaviruses in the Extracellular Space To Facilitate Entry into Host Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24614639 2014 [Neuropsin signaling as a novel therapeutic target of schizophrenia].
22505524 2012 Proteinase-activated receptors (PARs): differential signalling by kallikrein-related peptidases KLK8 and KLK14.
20940292 2011 Kallikrein-related peptidase-8 (KLK8) is an active serine protease in human epidermis and sweat and is involved in a skin barrier proteolytic cascade.
20614312 2008 Human kallikrein 8 expression in salivary gland tumors.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20360129 2010 Alternative splicing variant of kallikrein-related peptidase 8 as an independent predictor of unfavorable prognosis in lung cancer.
19558318 2009 Association between kallikrein-related peptidases (KLKs) and macroscopic indicators of semen analysis: their relation to sperm motility.
19194479 2009 SPINK9: a selective, skin-specific Kazal-type serine protease inhibitor.
19125171 2009 Functional characterization of the human-specific (type II) form of kallikrein 8, a gene involved in learning and memory.
19085836 2009 Multiple kallikrein (KLK 5, 7, 8, and 10) expression in squamous cell carcinoma of the oral cavity.
18354391 2008 Genetic variations of human neuropsin gene and psychiatric disorders: polymorphism screening and possible association with bipolar disorder and cognitive functions.
17761692 2007 SerpinB6 is an inhibitor of kallikrein-8 in keratinocytes.
17487847 2007 A human-specific mutation leads to the origin of a novel splice form of neuropsin (KLK8), a gene involved in learning and memory.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178872 2006 Human kallikrein 8 protease confers a favorable clinical outcome in non-small cell lung cancer by suppressing tumor cell invasiveness.
16800733 2006 Activation and enzymatic characterization of recombinant human kallikrein 8.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
16341674 2005 Transcriptome analysis of human gastric cancer.
16337200 2005 Biochemical characterization of human kallikrein 8 and its possible involvement in the degradation of extracellular matrix proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282331 2004 Recent origin of a hominoid-specific splice form of neuropsin, a gene involved in learning and memory.
15138549 2004 Human kallikrein 8 (hK8/TADG-14) expression is associated with an early clinical stage and favorable prognosis in ovarian cancer.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14749636 2004 The novel serine protease tumor-associated differentially expressed gene-14 (KLK8/Neuropsin/Ovasin) is highly overexpressed in cervical cancer.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12782581 2003 Human kallikrein 8, a novel biomarker for ovarian carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147714 2002 Epidermal expression of serine protease, neuropsin (KLK8) in normal and pathological skin samples.
11522960 2001 Expression of the kallikrein gene family in normal and Alzheimer's disease brain.
11309326 2001 The human KLK8 (neuropsin/ovasin) gene: identification of two novel splice variants and its prognostic value in ovarian cancer.
11054574 2000 Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.
10969073 2000 Tissue-specific expression patterns and fine mapping of the human kallikrein (KLK) locus on proximal 19q13.4.
10485494 1999 Cloning of tumor-associated differentially expressed gene-14, a novel serine protease overexpressed by ovarian carcinoma.
10102990 1999 A novel form of human neuropsin, a brain-related serine protease, is generated by alternative splicing and is expressed preferentially in human adult brain.
9714609 1998 Sequence analysis and expression of human neuropsin cDNA and gene.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.