Property Summary

NCBI Gene PubMed Count 86
PubMed Score 143.92
PubTator Score 142.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
ependymoma -2.300 2.2e-02
psoriasis 3.800 1.1e-03
cutaneous lupus erythematosus 3.300 1.4e-03
oligodendroglioma -1.200 7.3e-06
group 3 medulloblastoma -2.400 2.8e-02
atypical teratoid/rhabdoid tumor -1.900 3.5e-04
non-small cell lung cancer 1.203 2.4e-06
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-02
lung cancer 1.200 7.1e-04
active ulcerative colitis 1.700 4.4e-02
pancreatic cancer 1.600 5.5e-03
cystic fibrosis 1.600 2.3e-03
lung adenocarcinoma 1.100 2.9e-05
pediatric high grade glioma -1.600 7.9e-03
pilocytic astrocytoma -1.400 2.6e-02
subependymal giant cell astrocytoma -4.242 1.6e-03
spina bifida -1.000 1.2e-02
Pick disease -1.300 1.8e-02
progressive supranuclear palsy -1.500 1.4e-02
Breast cancer -1.800 5.9e-08
ovarian cancer 3.100 8.2e-07

Gene RIF (67)

PMID Text
26231762 Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival.
26172508 Data indicate that elevated expression of microRNA-375 in head and neck squamous cell carcinoma (HNSCC) cells significantly reduces kallikrein 6 (KLK6), kallikrein 10 (KLK10), and matrix metalloproteinase 9 (MMP9) messenger RNA expression.
25990935 KLK6 expression was detected in head and neck tumor cell lines (FaDu, Cal27 and SCC25), but not in HeLa cervix carcinoma cells.
25649006 KLK6 and KLK10 may be useful markers and potential therapeutic targets in gastroesophageal junction tumors
25477184 KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors.
25476568 The results of this study indicated that reductions in kallikrein-6 and calpain-1 may contribute to the accumulation of alpha-synuclein in DLB.
25153391 KLK6 may represent a potential unfavorable prognostic biomarker for colon cancer.
25153389 This study assessed the prognostic utility of human tissue kallikrein-like peptidases 6 and 10 (KLK6 and KLK10) and correlated their expression with histopathological and clinical parameters in gastric cancer.
24979321 Our data suggest that de novo KLK6 expression during early liver carcinogenesis may induce production of Ubi(1-74) by post-translational modification of ubiquitin
24669031 The level of KLK6 is significantly increased in the plasma samples from laryngeal cancer patients compared to the controls.
24643912 KLK6 promotes the proliferation of lung tumoral cells and restrains their apoptosis in vitro via ligand-dependent EGFR and was dependent on the protease-activated receptor 2.
24430362 KLK6 mRNA expression could be considered as an independent, unfavorable molecular prognostic biomarker in colorectal adenocarcinoma, with additional prognostic value in patients without regional or distant metastases
23308173 Patients with synucleinopathy displayed lower cerebrospinal fluid levels of neurosin and alpha-synuclein compared to controls and Alzheimer's disease patients.
23136250 hsa-let-7 family member hsa-let-7a is a modulator of KLK6 protein expression that is independent of the KLK6 copy number status
23049835 Decreased serum concentrations of KLK6 are found in patients with aneurysmal subarachnoid hemorrhage, with the lowest levels in patients who died
22874102 KLK6 DNA methylation was significantly associated with pathological stage in prostate cancer patients operated by radical prostatectomy.
22699826 in colorectal cancer patients, lymph node KLK6 positivity indicated presence of aggressive tumour cells associated with poor prognosis and high risk of tumour recurrence
22508489 Neuropathological analysis following delivery of LV-Neurosin to alpha-syn tg mice resulted in reduced accumulation of alpha-syn and reversal of neurodegenerative alterations in wild type but not A53T alpha-syn tg mice
22505521 KLK6 expressed by stromal cells may considerably contribute to the aggressiveness of ovarian cancer
22505518 KLK6 is positioned to serve as a molecular trigger of select physiological processes involved in the development of astrogliosis
22477710 KLK6 gene expression may have clinical utility as a marker of unfavorable prognosis for intracranial tumors, and consequently, it could be used as target for therapeutic intervention.
22373580 KLK6 is significantly upregulated and secreted in gastric cancer tissues and sera, suggesting that KLK6 might be used as a potential biomarker and therapeutic target for gastric cancer.
22285222 KLK6 immunostaining is an independent prognostic marker in patients with colorectal carcinoma.
22102857 High KLK6 is associated with ovarian cancer.
21753781 KLK6-induced intracellular Ca(2+) flux and tumor cell invasion critically depends on the protease-activated receptor 1 (PAR1).
21741862 Data indicate there was no SNP in KLK6 was associated with altered risk of prostate cancer.
21656738 KLK6 was up-regulated significantly in tissues and sera from patients with colon cancer and was associated closely with a poor prognosis.
21464892 KLK6 promotes lymphocyte survival by a mechanism that depends in part on activation of PAR1.
21193224 The expression of kallikrein 7 and kallikrein 6 in melanomas may be responsible for the loss of cell-cell adhesion.
20846516 an altered KLK6 expression may contribute to vascular abnormalities in Alzheimer's disease and vascular dementia
20836755 Patients diagnosed with advanced multiple sclerosis showed mean CSF levels of kallikrein-related peptidase 6 (29 ng/ml) that were significantly higher than in neurological controls (25.5 ng/ml).
20680316 upregulated in late stage epithelial ovarian cancer
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424135 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20403393 Neurosin targets extracellular alpha-synuclein in cultured cells.
19950700 The expression of hK6 in ovarian cancer was higher than that in benign and borderline ovarian neoplasms. Expression is higher in the ovarian cancer of late stage, higher-grade, with lymph node metastasis and is associated with a poorer prognosis.
19707197 KLK6 and KLK13 predict tumor recurrence in epithelial ovarian carcinoma.
19560453 Data show that it was unable to distinguish men with and without prostate cancer using multiple kallikreins as urinary biomarkers.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19426157 KLK6 has a role in tumour proliferation and progression of NSCLC
19423540 Observational study of gene-disease association. (HuGE Navigator)
19383923 KLK6 may play a protective role against tumor progression that is likely mediated by inhibition of epithelial-to-mesenchymal transition. KLK6 may be an epigenetically regulated tumor suppressor in human breast cancer
19088065 The aim of this study was to characterize and compare the N-glycosylation status of Kallikrein 6 in ovarian cancer ascites fluid and cerebrospinal fluid.
18992199 KLK6 expression in cancerous tissues may play an important role in the invasion and metastasis of primary breast carcinoma.
18957059 High tumor KLK6 protein expression is associated with inferior patient outcome in ovarian cancer.
18854834 Co-expression of KLK6 and KLK10 as prognostic factors for survival in pancreatic ductal adenocarcinoma.
18627290 the oncogenic role of KLK6 in colorectal cancer
18359858 KLK6 displayed trypsin-like activity, with the P1 position occupied only by Arg and a strong preference for Ser in P1'.
17158887 KLK6 may participate in epidermal desquamation through cleavage of desmoglein 1 and regulation by lympho-epithelial Kazal-type-related inhibitor (LEKTI).
16321973 hK6 expressed in the central nervous system is involved in normal myelin turnover/demyelination processes, but it is unlikely to self-activate
16203767 KLK6 is markedly overexpressed in gastric cancer tissue
15867230 Kallikrein 6 is highly expressed in uterine serous papillary carcinoma (USPC) and is released in the plasma and serum and may represent a novel biomarker for USPC for monitoring early disease recurrence and response to therapy.
15837738 Results indicated that KLK6 mRNA expression was significantly higher in cancerous than in noncancerous colorectal tissues.
15584920 Tissue-specific expression patterns and differential regulation in CNS disease indicates that each K6 5'-transcript is probably regulated by unique promoter elements and may serve as a molecular target to treat inflammatory demyelinating disease.
15557757 Human KLK6 might play a role in the invasion and metastasis of tumour cells and may be a candidate therapeutic target.
15255184 The enzymatic activity of hK6 is regulated by an autoactivation/autoinactivation mechanism. Mature hK6 displayed a trypsin-like activity against synthetic substrates and human plasminogen was identified as a putative physiological substrate for hK6
15207701 Distinct promoters regulate tissue-specific expression of KLK6 gene. Cloning of three novel transcript variants of KLK6 gene that encode for wild-type kallikrein 6 and of splice variants 2 and 3 produced by splicing out exons 3 and 4, respectively.
14696124 Downregulation of kallikrein 6 is associated with breast cancer
12928483 neurosin plays a significant role in physiological alpha-synuclein degradation and also in the pathogenesis of synucleinopathies
12878203 Characterization of the enzymatic activity of kallikrein 6.
12480753 Decreased cerebrospinal fluid levels may be a posssible risk factor for Alzheimer's disease
12232761 Immunofluorometric quantitation and histochemical localisation of kallikrein 6 protein in ovarian cancer tissue: a new independent unfavourable prognostic biomarker.
12074831 Decreased concentration of human kallikrein 6 in brain extracts of Alzheimer's disease patients
12023317 Kallikrein 6, a myelencephalon-specific protease expressed in the adult central nervous system (CNS), is present in inflammatory CNS lesions (e.g., multiple sclerosis) and in excess promotes CNS demyelination.
12016211 X-ray crystallographic structure of KLK6.
11983703 characterization of human kallikrein 6 as a degradative protease with structural features more similar to trypsin than the regulatory kallikreins

AA Sequence

MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV      1 - 70
FLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHI     71 - 140
LGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGL    141 - 210
VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK                                        211 - 244
//

Text Mined References (93)

PMID Year Title
26231762 2015 Prognostic significance of multiple kallikreins in high-grade astrocytoma.
26172508 2015 MicroRNA-375 Suppresses Extracellular Matrix Degradation and Invadopodial Activity in Head and Neck Squamous Cell Carcinoma.
25990935 2015 Kallikrein-related peptidase 6 regulates epithelial-to-mesenchymal transition and serves as prognostic biomarker for head and neck squamous cell carcinoma patients.
25649006 2015 Evaluation of human tissue kallikrein-related peptidases 6 and 10 expression in early gastroesophageal adenocarcinoma.
25477184 2014 Kallikrein family proteases KLK6 and KLK7 are potential early detection and diagnostic biomarkers for serous and papillary serous ovarian cancer subtypes.
25476568 2014 Accumulation of ?-synuclein in dementia with Lewy bodies is associated with decline in the ?-synuclein-degrading enzymes kallikrein-6 and calpain-1.
25153391 2014 Kallikrein-related peptidase 6 (KLK6) expression in the progression of colon adenoma to carcinoma.
25153389 2014 Prognostic significance of human tissue kallikrein-related peptidases 6 and 10 in gastric cancer.
24979321 2014 Progression from cirrhosis to cancer is associated with early ubiquitin post-translational modifications: identification of new biomarkers of cirrhosis at risk of malignancy.
24669031 2014 Identification of human tissue kallikrein 6 as a potential marker of laryngeal cancer based on the relevant secretory/releasing protein database.
24643912 2014 Growth and survival of lung cancer cells: regulation by kallikrein-related peptidase 6 via activation of proteinase-activated receptor 2 and the epidermal growth factor receptor.
24430362 2014 Kallikrein-related peptidase-6 (KLK6) mRNA expression is an independent prognostic tissue biomarker of poor disease-free and overall survival in colorectal adenocarcinoma.
23308173 2013 Low CSF levels of both ?-synuclein and the ?-synuclein cleaving enzyme neurosin in patients with synucleinopathy.
23136250 2013 Copy number and expression alterations of miRNAs in the ovarian cancer cell line OVCAR-3: impact on kallikrein 6 protein expression.
23049835 2012 Kallikrein 6 as a serum prognostic marker in patients with aneurysmal subarachnoid hemorrhage.
22874102 2012 Quantitative DNA methylation analysis of genes coding for kallikrein-related peptidases 6 and 10 as biomarkers for prostate cancer.
22699826 2012 Lymph node tissue kallikrein-related peptidase 6 mRNA: a progression marker for colorectal cancer.
22508489 2013 Lentivirus mediated delivery of neurosin promotes clearance of wild-type ?-synuclein and reduces the pathology in an ?-synuclein model of LBD.
22505521 2012 Stromal cell-associated expression of kallikrein-related peptidase 6 (KLK6) indicates poor prognosis of ovarian cancer patients.
22505518 2012 Kallikrein 6 is a novel molecular trigger of reactive astrogliosis.
22477710 2012 Kallikrein-related peptidase 6 (KLK6)gene expression in intracranial tumors.
22373580 2012 Upregulation and secretion of kallikrein-related peptidase 6 (KLK6) in gastric cancer.
22285222 2012 Evaluation and prognostic significance of human tissue kallikrein-related peptidase 6 (KLK6) in colorectal cancer.
22166940 2012 A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease.
22102857 2011 Kallikreins 5, 6 and 10 differentially alter pathophysiology and overall survival in an ovarian cancer xenograft model.
22047144 2011 The physiology and pathobiology of human kallikrein-related peptidase 6 (KLK6).
21753781 2011 Expression and function of the kallikrein-related peptidase 6 in the human melanoma microenvironment.
21741862 2013 Common variation in Kallikrein genes KLK5, KLK6, KLK12, and KLK13 and risk of prostate cancer and tumor aggressiveness.
21656738 2011 Up-regulation and clinical significance of serine protease kallikrein 6 in colon cancer.
21464892 2011 Functional role of kallikrein 6 in regulating immune cell survival.
21193224 2011 Cell adhesion and communication proteins are differentially expressed in melanoma progression model.
20846516 2010 Kallikrein-related peptidase 6 in Alzheimer's disease and vascular dementia.
20836755 2010 Human kallikrein 6 cerebrospinal levels are elevated in multiple sclerosis.
20680316 2011 The association with age, human tissue kallikreins 6 and 10 and hemostatic markers for survival outcome from epithelial ovarian cancer.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20403393 2010 Extracellular neurosin degrades ?-synuclein in cultured cells.
19950700 2009 [Correlation of hK6 expression with clinicopathological features and prognosis in epithelial ovarian cancer].
19707197 2009 KLK6 and KLK13 predict tumor recurrence in epithelial ovarian carcinoma.
19560453 2009 The kallikrein family of proteins as urinary biomarkers for the detection of prostate cancer.
19558318 2009 Association between kallikrein-related peptidases (KLKs) and macroscopic indicators of semen analysis: their relation to sperm motility.
19426157 2009 High kallikrein-related peptidase 6 in non-small cell lung cancer cells: an indicator of tumour proliferation and poor prognosis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19383923 2009 A tumor-protective role for human kallikrein-related peptidase 6 in breast cancer mediated by inhibition of epithelial-to-mesenchymal transition.
19088065 2009 Differential N-glycosylation of kallikrein 6 derived from ovarian cancer cells or the central nervous system.
18992199 2008 [Expression of KLK6 protein and mRNA in primary breast cancer and its clinical significance].
18957059 2008 Prognostic value of kallikrein-related peptidase 6 protein expression levels in advanced ovarian cancer evaluated by automated quantitative analysis (AQUA).
18854834 2008 Co-expression of KLK6 and KLK10 as prognostic factors for survival in pancreatic ductal adenocarcinoma.
18627290 2008 Kallikrein 6 is a mediator of K-RAS-dependent migration of colon carcinoma cells.
18359858 2008 Substrate specificity of human kallikreins 1 and 6 determined by phage display.
17417874 2007 The autolytic regulation of human kallikrein-related peptidase 6.
17158887 2007 A potential role for multiple tissue kallikrein serine proteases in epidermal desquamation.
16987227 2006 Dynamic role of kallikrein 6 in traumatic spinal cord injury.
16885167 2006 Proteinase-activated receptors, targets for kallikrein signaling.
16800739 2006 Multiple mechanisms underlie the aberrant expression of the human kallikrein 6 gene in breast cancer.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16341674 2005 Transcriptome analysis of human gastric cancer.
16321973 2006 Substrate specificity of human kallikrein 6: salt and glycosaminoglycan activation effects.
16203767 2005 Clinicopathologic and biological significance of kallikrein 6 overexpression in human gastric cancer.
15867230 2005 Human kallikrein 6: a new potential serum biomarker for uterine serous papillary cancer.
15837738 2005 Clinical significance of human kallikrein gene 6 messenger RNA expression in colorectal cancer.
15627893 In silico analysis of the human kallikrein gene 6.
15584920 2004 Distinct promoters regulate tissue-specific and differential expression of kallikrein 6 in CNS demyelinating disease.
15557757 Human kallikrein 6 degrades extracellular matrix proteins and may enhance the metastatic potential of tumour cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15255184 2004 Human kallikrein 6 activity is regulated via an autoproteolytic mechanism of activation/inactivation.
15207701 2004 Cloning and characterization of novel isoforms of the human kallikrein 6 gene.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14696124 2004 Association of kallikrein expression in nipple aspirate fluid with breast cancer risk.
12928483 2003 Alpha-synuclein degradation by serine protease neurosin: implication for pathogenesis of synucleinopathies.
12878203 2003 Characterization of the enzymatic activity of human kallikrein 6: Autoactivation, substrate specificity, and regulation by inhibitors.
12709365 2003 Purification of human kallikrein 6 from biological fluids and identification of its complex with alpha(1)-antichymotrypsin.
12589961 2003 Role of kallikrein enzymes in the central nervous system.
12480753 2002 Decreased cerebrospinal fluid levels of neurosin (KLK6), an aging-related protease, as a possible new risk factor for Alzheimer's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12232761 2002 Immunofluorometric quantitation and histochemical localisation of kallikrein 6 protein in ovarian cancer tissue: a new independent unfavourable prognostic biomarker.
12074831 2002 Decreased concentration of human kallikrein 6 in brain extracts of Alzheimer's disease patients.
12023317 2002 Activity of a newly identified serine protease in CNS demyelination.
12016211 2002 The structure of human prokallikrein 6 reveals a novel activation mechanism for the kallikrein family.
11983703 2002 Crystal structure and biochemical characterization of human kallikrein 6 reveals that a trypsin-like kallikrein is expressed in the central nervous system.
11668196 2001 The spectrum of human kallikrein 6 (zyme/protease M/neurosin) expression in human tissues as assessed by immunohistochemistry.
11054574 2000 Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.
11018688 2000 Immunofluorometric assay of human kallikrein 6 (zyme/protease M/neurosin) and preliminary clinical applications.
10997858 2000 Localization of a novel type trypsin-like serine protease, neurosin, in brain tissues of Alzheimer's disease and Parkinson's disease.
10610719 1999 Molecular characterization of zyme/protease M/neurosin (PRSS9), a hormonally regulated kallikrein-like serine protease.
9312124 1997 Zyme, a novel and potentially amyloidogenic enzyme cDNA isolated from Alzheimer's disease brain.
9003450 1997 Molecular cloning of a novel trypsin-like serine protease (neurosin) preferentially expressed in brain.
8898378 1996 A novel protease homolog differentially expressed in breast and ovarian cancer.