Property Summary

NCBI Gene PubMed Count 59
PubMed Score 81.03
PubTator Score 77.93

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING      1 - 70
SDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSI     71 - 140
PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNIS    141 - 210
VLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK    211 - 280
FTKWIQETIQANS                                                             281 - 293
//