Property Summary

Ligand Count 12
NCBI Gene PubMed Count 59
PubMed Score 81.03
PubTator Score 77.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.800 9.9e-03
Atopic dermatitis -2.300 1.5e-03
Breast cancer -3.300 1.5e-23
breast carcinoma -1.100 1.1e-02
diabetes mellitus 1.400 1.1e-03
ependymoma -2.000 1.7e-02
esophageal adenocarcinoma -1.300 4.1e-02
invasive ductal carcinoma -1.500 4.1e-02
oligodendroglioma -1.900 8.9e-03

Gene RIF (44)

AA Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING      1 - 70
SDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSI     71 - 140
PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNIS    141 - 210
VLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK    211 - 280
FTKWIQETIQANS                                                             281 - 293
//

Text Mined References (63)

PMID Year Title