Property Summary

Ligand Count 25
NCBI Gene PubMed Count 394
PubMed Score 19470.78
PubTator Score 239.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 1.6e-04

Protein-protein Interaction (6)

Gene RIF (339)

AA Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNK      1 - 70
SVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMD     71 - 140
LPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCS    141 - 210
GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP                       211 - 261
//

Text Mined References (396)

PMID Year Title