Property Summary

NCBI Gene PubMed Count 394
PubMed Score 19470.78
PubTator Score 239.83

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (6)

AA Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNK      1 - 70
SVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMD     71 - 140
LPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCS    141 - 210
GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP                       211 - 261
//