Property Summary

NCBI Gene PubMed Count 35
PubMed Score 148.35
PubTator Score 33.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.300 2.8e-04
juvenile dermatomyositis -1.097 4.2e-10
intraductal papillary-mucinous carcinoma... -1.200 2.1e-02
active Crohn's disease -1.053 4.5e-02
adult high grade glioma -1.200 6.8e-03
spina bifida 1.042 3.7e-02
ovarian cancer -1.100 4.8e-05

Gene RIF (17)

PMID Text
23620432 KLK15 mRNA expression levels are a novel marker for the differential diagnosis of prostate cancer.
23391636 Advanced pathologic stage was associated with significantly higher expression of KLK15 and PCA3 mRNAs.
22132073 These findings suggest a role for KLK15 genetic variation in the etiology of prostate cancer among men of European ancestry.
21457553 association with ovarian cancer survival
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20473923 Multivariate analysis identified dichotomised KLK15 expression, corrected for patient parameters age, preoperative prostate-specific antigen level, pathological tumour stage, Gleason score and surgical margins, as an prognostic factor for poor outcome.
20460480 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424135 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20067463 KLK15 expression analysis could be employed as a valuable tool for the discrimination between benign prostatic hyperplasia and prostate cancer tissue specimens and as an unfavorable prognostic marker for prostate cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
19823874 Data show six non-synonymous amino acid or frame shift changes in the KLK3 gene and three changes in each of the neighboring genes, KLK15 and KLK2.
19423540 Observational study of gene-disease association. (HuGE Navigator)
12915603 KLK15 expression, as assessed by quantitative RT-PCR, is an independent marker of unfavorable prognosis for ovarian cancer.
12439720 Kallikrein 15 expression is an independent prognostic factors of progression-free and overall survival in breast cancer patients

AA Sequence

MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRV      1 - 70
RLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVV     71 - 140
SGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSG    141 - 210
GPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMKRN                            211 - 256
//

Text Mined References (36)

PMID Year Title
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25416956 2014 A proteome-scale map of the human interactome network.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23620432 2013 Quantified KLK15 gene expression levels discriminate prostate cancer from benign tumors and constitute a novel independent predictor of disease progression.
23391636 2013 Association of transcript levels of 10 established or candidate-biomarker gene targets with cancerous versus non-cancerous prostate tissue from radical prostatectomy specimens.
22505514 2012 Kallikrein-related peptidases in prostate, breast, and ovarian cancers: from pathobiology to clinical relevance.
22132073 2011 Association between Prostinogen (KLK15) genetic variants and prostate cancer risk and aggressiveness in Australia and a meta-analysis of GWAS data.
21457553 2011 A Kallikrein 15 (KLK15) single nucleotide polymorphism located close to a novel exon shows evidence of association with poor ovarian cancer survival.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20473923 2010 KLK15 is a prognostic marker for progression-free survival in patients with radical prostatectomy.
20460480 2010 Susceptibility loci associated with prostate cancer progression and mortality.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20067463 2010 Expression analysis and study of the KLK15 mRNA splice variants in prostate cancer and benign prostatic hyperplasia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
19823874 2010 A comprehensive resequence analysis of the KLK15-KLK3-KLK2 locus on chromosome 19q13.33.
19819870 2009 Functional roles of human kallikrein-related peptidases.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
12915603 2003 Prognostic value of the human kallikrein gene 15 expression in ovarian cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439720 2002 The androgen-regulated gene human kallikrein 15 (KLK15) is an independent and favourable prognostic marker for breast cancer.
11901813 2001 Human tissue kallikrein gene family: a rich source of novel disease biomarkers.
11327827 2001 Activation of prostate-specific antigen precursor (pro-PSA) by prostin, a novel human prostatic serine protease identified by degenerate PCR.
11054574 2000 Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.
11010966 2001 Molecular cloning of the human kallikrein 15 gene (KLK15). Up-regulation in prostate cancer.
11006094 2000 Genomic organization of the human kallikrein gene family on chromosome 19q13.3-q13.4.
10675891 2000 The new human kallikrein gene family: implications in carcinogenesis.
8018728 1994 A novel serine proteinase-like sequence from human brain.