Property Summary

NCBI Gene PubMed Count 33
PubMed Score 22.34
PubTator Score 36.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 3.4e-05
Disease Target Count Z-score Confidence
Netherton syndrome 14 4.611 2.3
Atopic dermatitis 944 3.03 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.091 3.4e-05

Gene RIF (23)

PMID Text
23224034 KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients.
22505524 KLK8 and KLK14 can signal differentially via the PARs to affect tissue function
22505523 KLK14, acting via PAR-2, represents an autocrine/paracrine regulator of colon tumorigenesis
22505522 genetic variants in the KLK14 locus are associated with risk and/or aggressiveness of prostate cancer
21057706 KLK14 gene expression could be evaluated as a putative independent diagnostic biomarker in breast tumour biopsies.
20424135 Observational study of gene-disease association. (HuGE Navigator)
20155713 The differences in the levels of KLK14 suggest that KLKs may aid in the differential diagnosis of salivary gland tumors. The coexpression of KLKs suggests their possible involvement in an enzymatic pathway activated in salivary gland.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19383315 synergistic effects between estrogens and androgens on estrogen-sensitive genes may have implications on the role of the kallikreins 10, 11, and 14 in associated risk of breast cancer and progression.
19147544 KLK4 is only expressed in breast and prostate cancers that express the progesterone receptor (PR) and androgen receptor (AR), respectively.
18627302 positive staining was significantly associated with NSCLC adenocarcinoma histotype (KLK13, p=0.014) and tumor size (KLK14, p=0.048)
18497543 Expression of the KLK14 protein correlated with the pathological tumor status in prostate cancer and was associated with disease progression defined by prostate-specific antigen relapse in univariate Kaplan-Meier analysis.
18482984 semenogelins I and II were directly cleaved by KLK14. Semenogelins were also able to reverse KLK14 inhibition by Zn2+, providing a novel regulatory mechanism for KLK14 activity.
18056261 KLK14 is a new activator component of the KLK proteolytic cascade with a possible role in seminal plasma and skin
17625593 KLK5 and KLK14, but neither KLK7 nor KLK8, induced PAR2 signalling.
17158887 KLK14 may participate in epidermal desquamation through cleavage of desmoglein 1 and regulation by lympho-epithelial Kazal-type-related inhibitor (LEKTI).
17110383 KLK14 may be implicated in several facets of tumor progression, including growth, invasion, and angiogenesis, as well as in arthritic disease via deterioration of cartilage
16800737 The majority of KLK14 in the plantar stratum corneum is present in its catalytically active form. KLK14 could be immunohistochemically detected in sweat ducts, preferentially in the intraepidermal parts (the acrosyringium), and in sweat glands.
16434994 KLK14 is clearly overexpressed in breast cancer in comparison to normal breast tissues and is positively associated with conventional parameters of tumour aggressiveness
15843175 hK14 has dual activity, trypsin- and chymotrypsin-like, with a preference for cleavage after arginine residues
15654974 may be part of a protease cascade in the stratum corneum, and that the observed pH effects may have physiological relevance.
12858357 KLK14 expression upregulated in advanced and more aggressive prostate tumors; may play role in tumor spread and may be new marker for prostate cancer diagnosis and prognosis
12439719 KLK14 overexpression was found to be a significant predictor of decreased disease-free survival and overall survival in breast cancer patients

AA Sequence

MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGG      1 - 70
ALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIG     71 - 140
RAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQ    141 - 210
GGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK                 211 - 267
//

Text Mined References (36)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23224034 2013 Parallel overexpression and clinical significance of kallikrein-related peptidases 7 and 14 (KLK7KLK14) in colon cancer.
22505524 2012 Proteinase-activated receptors (PARs): differential signalling by kallikrein-related peptidases KLK8 and KLK14.
22505523 2012 Kallikrein-related peptidase signaling in colon carcinoma cells: targeting proteinase-activated receptors.
22505522 2012 The kallikrein 14 gene is down-regulated by androgen receptor signalling and harbours genetic variation that is associated with prostate tumour aggressiveness.
21057706 2011 Quantitative expression analysis and study of the novel human kallikrein-related peptidase 14 gene (KLK14) in malignant and benign breast tissues.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20155713 Human kallikrein 14 (KLK14) expression in salivary gland tumors.
19558318 2009 Association between kallikrein-related peptidases (KLKs) and macroscopic indicators of semen analysis: their relation to sperm motility.
19383315 2008 Androgens act synergistically to enhance estrogen-induced upregulation of human tissue kallikreins 10, 11, and 14 in breast cancer cells via a membrane bound androgen receptor.
19147544 2009 Direct progesterone receptor and indirect androgen receptor interactions with the kallikrein-related peptidase 4 gene promoter in breast and prostate cancer.
18627302 2008 Quantitative RT-PCR analysis and immunohistochemical localization of the kallikrein-related peptidases 13 and 14 in lung.
18497543 2008 High expression of KLK14 in prostatic adenocarcinoma is associated with elevated risk of prostate-specific antigen relapse.
18482984 2008 Major role of human KLK14 in seminal clot liquefaction.
18056261 2008 Human kallikrein-related peptidase 14 (KLK14) is a new activator component of the KLK proteolytic cascade. Possible function in seminal plasma and skin.
17922479 2007 Understanding the accuracy of statistical haplotype inference with sequence data of known phase.
17625593 2008 Activation of proteinase-activated receptor-2 by human kallikrein-related peptidases.
17158887 2007 A potential role for multiple tissue kallikrein serine proteases in epidermal desquamation.
17110383 2007 Expression and functional characterization of the cancer-related serine protease, human tissue kallikrein 14.
16885167 2006 Proteinase-activated receptors, targets for kallikrein signaling.
16800737 2006 Kallikrein-related peptidase 14 may be a major contributor to trypsin-like proteolytic activity in human stratum corneum.
16800724 2006 A comprehensive nomenclature for serine proteases with homology to tissue kallikreins.
16800723 2006 Proceedings of the 1st International Symposium on Kallikreins, Lausanne, Switzerland, September 1-3 , 2005.
16456535 2006 Quantification of eight tissue kallikreins in the stratum corneum and sweat.
16434994 2006 Expression of human Kallikrein 14 (KLK14) in breast cancer is associated with higher tumour grades and positive nodal status.
15843175 2005 Enzymatic profiling of human kallikrein 14 using phage-display substrate technology.
15654974 2005 A proteolytic cascade of kallikreins in the stratum corneum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12858357 2003 Differential expression of the human kallikrein gene 14 (KLK14) in normal and cancerous prostatic tissues.
12645335 2003 Steroid hormone regulation and prognostic value of the human kallikrein gene 14 in ovarian cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439719 2002 Quantitative analysis of human kallikrein gene 14 expression in breast tumours indicates association with poor prognosis.
11352573 2001 Identification and characterization of KLK14, a novel kallikrein serine protease gene located on human chromosome 19q13.4 and expressed in prostate and skeletal muscle.
11309303 2001 Cloning of a new member of the human kallikrein gene family, KLK14, which is down-regulated in different malignancies.
10969073 2000 Tissue-specific expression patterns and fine mapping of the human kallikrein (KLK) locus on proximal 19q13.4.