Property Summary

Ligand Count 3
NCBI Gene PubMed Count 34
PubMed Score 23.67
PubTator Score 36.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.4e-05
Disease Target Count Z-score Confidence
Netherton syndrome 15 4.819 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.091 3.4e-05

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGG      1 - 70
ALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIG     71 - 140
RAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQ    141 - 210
GGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK                 211 - 267
//

Text Mined References (37)

PMID Year Title