Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.04
PubTator Score 17.38

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWV      1 - 70
RLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTEC     71 - 140
HVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVL    141 - 210
QGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN                                    211 - 248
//