Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.04
PubTator Score 17.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.563 2.0e-02
active ulcerative colitis 1.544 9.2e-03
cutaneous lupus erythematosus 1.700 1.6e-02
esophageal adenocarcinoma -2.300 2.2e-02
non-small cell lung cancer 1.027 2.9e-04
osteosarcoma 1.887 1.2e-09
psoriasis 1.600 2.0e-04

Gene RIF (13)

AA Sequence

MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWV      1 - 70
RLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTEC     71 - 140
HVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVL    141 - 210
QGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN                                    211 - 248
//

Text Mined References (24)

PMID Year Title