Property Summary

NCBI Gene PubMed Count 42
PubMed Score 259.39
PubTator Score 109.93

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA      1 - 70
LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR     71 - 140
NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY    141 - 210
PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK    211 - 280
NN                                                                        281 - 282
//