Property Summary

NCBI Gene PubMed Count 61
PubMed Score 58.31
PubTator Score 71.95

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFH      1 - 70
CAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLML     71 - 140
LKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVT    141 - 210
NNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN        211 - 276
//