Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.81
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.900 8.3e-05
medulloblastoma, large-cell -3.000 5.8e-05
juvenile dermatomyositis 1.069 4.2e-08
pancreatic ductal adenocarcinoma liver m... -1.382 3.6e-02
tuberculosis -1.100 2.1e-06
intraductal papillary-mucinous adenoma (... -2.100 1.1e-02
active Crohn's disease 1.181 1.8e-02
interstitial cystitis 1.600 7.9e-05
primary Sjogren syndrome 1.300 1.8e-04
lung carcinoma -1.300 6.8e-11
gastric carcinoma 1.300 2.5e-02
ulcerative colitis 3.500 2.5e-07
ovarian cancer 1.400 2.1e-02
pancreatic cancer 1.200 2.3e-02

Gene RIF (1)

PMID Text
14672410 Data report a novel splicing variant of KLHL5, named KLHL5b, and describe its expression pattern in many tissues.

AA Sequence

MNVIYFPLHIFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQILKIRWRWFGHQ      1 - 70
ASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEVPAFE     71 - 140
FTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQTLSSCHTMEPCTSDEFFQALNHAEQTFKKM    141 - 210
ENYLRHKQLCDVILVAGDRRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYT    211 - 280
GRLELKEDNIECLLSTACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFM    281 - 350
EVIRNQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLA    351 - 420
DMENNVLFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGMDSTKGATSIEKYDLR    421 - 490
TNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLE    491 - 560
GPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDP    561 - 630
HTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDA    631 - 700
VGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL                   701 - 755
//

Text Mined References (9)

PMID Year Title
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
21294900 2011 A genome-wide association study of serum uric acid in African Americans.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672410 2003 Characterization of a novel splicing variant of KLHL5, a member of the kelch protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590829 2001 Cloning and characterization of KLHL5, a novel human gene encoding a kelch-related protein with a BTB domain.