Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.04
PubTator Score 2.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 4.2e-05
atypical teratoid / rhabdoid tumor -1.900 1.3e-05
glioblastoma -1.100 2.0e-03
group 4 medulloblastoma -1.200 1.3e-02
medulloblastoma, large-cell -1.700 1.1e-03
nasopharyngeal carcinoma 1.100 3.5e-04
non-small cell lung cancer 1.228 1.0e-14
osteosarcoma 3.290 2.2e-05
ovarian cancer -1.300 1.7e-03
posterior fossa group A ependymoma -1.100 6.2e-05
subependymal giant cell astrocytoma -1.043 2.8e-02

Gene RIF (1)

AA Sequence

MSAEEMVQIRLEDRCYPVSKRKLIEQSDYFRALYRSGMREALSQEAGGPEVQQLRGLSAPGLRLVLDFIN      1 - 70
AGGAREGWLLGPRGEKGGGVDEDEEMDEVSLLSELVEAASFLQVTSLLQLLLSQVRLNNCLEMYRLAQVY     71 - 140
GLPDLQEACLRFMVVHFHEVLCKPQFHLLGSPPQAPGDVSLKQRLREARMTGTPVLVALGDFLGGPLAPH    141 - 210
PYQGEPPSMLRYEEMTERWFPLANNLPPDLVNVRGYGSAILDNYLFIVGGYRITSQEISAAHSYNPSTNE    211 - 280
WLQVASMNQKRSNFKLVAVNSKLYAIGGQAVSNVECYNPEQDAWNFVAPLPNPLAEFSACECKGKIYVIG    281 - 350
GYTTRDRNMNILQYCPSSDMWTLFETCDVHIRKQQMVSVEETIYIVGGCLHELGPNRRSSQSEDMLTVQS    351 - 420
YNTVTRQWLYLKENTSKSGLNLTCALHNDGIYIMSRDVTLSTSLEHRVFLKYNIFSDSWEAFRRFPAFGH    421 - 490
NLLVSSLYLPNKAET                                                           491 - 505
//

Text Mined References (11)

PMID Year Title