Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.17
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 1.9e-05
Astrocytoma, Pilocytic -1.600 2.0e-08
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
ependymoma -1.600 6.6e-19
glioblastoma -1.200 6.1e-06
sonic hedgehog group medulloblastoma 1.100 1.0e-02

AA Sequence

MRQGHAPEESEPGCEAPCAGPCHAQRVLQALNAYRRSGTLTDVVLRAGGRDFPCHRAALSAGSAYFRSLF      1 - 70
AAGRPERGPAVVPVVPVAPEAPGTSPAGAAAALAVVLDYVYGAGVRLRAEDEAAAVLALAERLGVAGLRE     71 - 140
ACVRFLEGRLRAANSLALRRVAAAFSLAPLAERCGRVLRQAFAEVARHADFLELAPDEVVALLADPALGV    141 - 210
AREEAVFEAAMRWVRHDAPARRGQLRRLLEHVRLPLLAPAYFLEKVEADELLQACGECRPLLLEARACFI    211 - 280
LGREAGALRTRPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTRSEFAACALRN    281 - 350
DVYVSGGHINSHDVWMFSSHLHTWIKVASLHKGRWRHKMAVVQGQLFAVGGFDGLRRLHSVERYDPFSNT    351 - 420
WAAAAPLPEAVSSAAVASCAGKLFVIGGARQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDT    421 - 490
IYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVE    491 - 560
VQPSLQRCTSSHGCVTIIQSLGR                                                   561 - 583
//

Text Mined References (6)

PMID Year Title