Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.58
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -2.100 7.0e-03
medulloblastoma -2.700 6.1e-08
atypical teratoid / rhabdoid tumor -2.900 3.1e-08
medulloblastoma, large-cell -2.200 2.9e-04
active ulcerative colitis 1.125 3.4e-02
pediatric high grade glioma -1.600 1.1e-02
posterior fossa group B ependymoma 1.200 2.1e-03
subependymal giant cell astrocytoma -2.045 1.3e-02
pituitary cancer 1.700 8.9e-04
chronic rhinosinusitis -1.437 2.2e-02

Synonym

Accession Q96NJ5 B7Z346 B7Z4E2 E1P528 Q5THT0 Q96PY7
Symbols BKLHD5
KIAA1900
dJ21F7.1
UG0030H05

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPSERCLSIQEMLTGQRLCHSESHNDSVLAALNQQRSDGILCDITLIAEEQKFHAHKAVLAACSDYFRAM      1 - 70
FSLCMVESGADEVNLHGVTSLGLKQALEFAYTGQILLEPGVIQDVLAAGSHLQLLELLNLCSHYLIQELN     71 - 140
SFNYLDLYRLADLFNLTLLEKAVIDFLVKHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQL    141 - 210
AVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTR    211 - 280
RTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENALIAAIANWSELAPMPVGRSHHCVAVMGDFLFV    281 - 350
AGGEVEHASGRTCAVRTACRYDPRSNSWAEIAPMKNCREHFVLGAMEEYLYAVGGRNELRQVLPTVERYC    351 - 420
PKKNKWTFVQSFDRSLSCHAGYVADGLLWISGGVTNTAQYQNRLMVYEPNQNKWISRSPMLQRRVYHSMA    421 - 490
AVQRKLYVLGGNDLDYNNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRIYLVGGYSIWTN    491 - 560
EPLACIQVLDVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGTI              561 - 620
//

Text Mined References (9)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
23785401 2013 Association of genetic markers with CSF oligoclonal bands in multiple sclerosis patients.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.