Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.24
PubTator Score 2.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 7.4e-04
ductal carcinoma in situ -2.700 6.8e-04
invasive ductal carcinoma -3.000 2.4e-03

Gene RIF (1)

AA Sequence

MAPKKKIVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLLEGLSKMRQEN      1 - 70
FLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSIQRVDLNDISPLGLATVIAYAYTGKLTLSLYTI     71 - 140
GSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFAESDQFMK    141 - 210
LTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQ    211 - 280
DADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTE    281 - 350
MPAKSFNQCVAVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQKRTHFSLSVFNGL    351 - 420
VYAAGGRNAEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVADGRVLVTGGYIANAYSRSVCAYDPAS    421 - 490
DSWQELPNLSTPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAPLQVGVSTAGV    491 - 560
SALHGRAYLVGGWNEGEKKYKKCIQCFSPELNEWTEDDELPEATVGVSCCTLSMPNNVTRESRASSVSSV    561 - 630
PVSI                                                                      631 - 634
//

Text Mined References (8)

PMID Year Title