Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.900 4.9e-03
oligodendroglioma -1.300 3.8e-02
posterior fossa group A ependymoma -1.400 1.0e-07
glioblastoma -1.700 3.0e-04
atypical teratoid / rhabdoid tumor -1.200 2.1e-02
medulloblastoma, large-cell 1.300 3.9e-04
acute quadriplegic myopathy 1.214 1.3e-09
adrenocortical carcinoma -2.416 9.1e-06
active Crohn's disease 1.272 7.0e-03
breast carcinoma -1.900 2.3e-06
adult high grade glioma -1.700 3.3e-05
group 3 medulloblastoma 1.700 2.1e-04
pilocytic astrocytoma -2.300 6.5e-11
Breast cancer -3.500 7.4e-41
gastric carcinoma 2.600 1.7e-02
ductal carcinoma in situ -1.700 9.2e-05
invasive ductal carcinoma -2.800 2.5e-05
ulcerative colitis 1.700 1.3e-07
ovarian cancer 1.600 1.5e-05
pituitary cancer -2.000 1.3e-03

Synonym

Accession Q96CT2 Q8N388 Q96BF0 Q96PW7
Symbols KBTBD9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRHHSRFERDYRVGWDRREWSVNGTHGTTSICSVTSGAGGGTASSLSVRPGLLPLPVVPSRLPTPATAP      1 - 70
APCTTGSSEAITSLVASSASAVTTKAPGISKGDSQSQGLATSIRWGQTPINQSTPWDTDEPPSKQMRESD     71 - 140
NPGTGPWVTTVAAGNQPTLIAHSYGVAQPPTFSPAVNVQAPVIGVTPSLPPHVGPQLPLMPGHYSLPQPP    141 - 210
SQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPA    211 - 280
TNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASC    281 - 350
SLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC    351 - 420
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLN    421 - 490
TKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYH    491 - 560
MLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFS    561 - 630
VVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHV    631 - 700
ERYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKY    701 - 770
APAVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM    771 - 840
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG                                       841 - 875
//

Text Mined References (14)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.