Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 1.8e-03
glioblastoma -1.100 1.5e-04
group 3 medulloblastoma -1.100 1.6e-03
malignant mesothelioma -2.500 5.8e-07
oligodendroglioma -1.600 4.4e-02
pediatric high grade glioma -1.100 2.4e-04
subependymal giant cell astrocytoma -1.026 4.4e-02

AA Sequence

MAESGGSSGGAGGGGAFGAGPGPERPNSTADKNGALKCTFSAPSHSTSLLQGLATLRAQGQLLDVVLTIN      1 - 70
REAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGVSARGLRHIIDFAYSAEVTLDLDCVQDVLGAA     71 - 140
VFLQMLPVVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEEDFLRLPLERLV    141 - 210
FFLQSNRLQSCAEIDLFRAAVRWLQHDPARRPRASHVLCHIRFPLMQSSELVDSVQTLDIMVEDVLCRQY    211 - 280
LLEAFNYQVLPFRQHEMQSPRTAVRSDVPSLVTFGGTPYTDSDRSVSSKVYQLPEPGARHFRELTEMEVG    281 - 350
CSHTCVAVLDNFVYVAGGQHLQYRSGEGAVDACYRYDPHLNRWLRLQAMQESRIQFQLNVLCGMVYATGG    351 - 420
RNRAGSLASVERYCPRRNEWGYACSLKRRTWGHAGAASGGRLYISGGYGISVEDKKALHCYDPVADQWEF    421 - 490
KAPMSEPRVLHAMVGAGGRIYALGGRMDHVDRCFDVLAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERK    491 - 560
IYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAGIACAPVLLPRAGTRR                   561 - 615
//

Text Mined References (9)

PMID Year Title