Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.77
PubTator Score 3.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.100 8.9e-05
Multiple myeloma 1.258 2.6e-02
astrocytic glioma 1.300 1.5e-02
ependymoma 1.400 2.8e-03
oligodendroglioma 1.500 1.3e-03
psoriasis -2.300 4.5e-03
osteosarcoma 1.303 5.7e-04
group 4 medulloblastoma 2.000 8.3e-07
cystic fibrosis 1.738 6.9e-04
medulloblastoma, large-cell 1.300 1.2e-03
limb girdle muscular dystrophy 2I -1.165 4.7e-03
tuberculosis -1.300 2.3e-04
pancreatic ductal adenocarcinoma liver m... 1.399 8.1e-03
intraductal papillary-mucinous adenoma (... 2.100 9.4e-05
intraductal papillary-mucinous carcinoma... 1.800 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 7.0e-03
Breast cancer 2.300 2.5e-02
aldosterone-producing adenoma -1.474 1.0e-02
spina bifida -3.013 1.4e-02
Pick disease 1.100 6.0e-05
invasive ductal carcinoma -1.100 1.1e-02
ulcerative colitis -1.300 6.5e-04
ovarian cancer 1.100 3.8e-03
pituitary cancer -1.300 5.8e-06

Synonym

Accession Q6TFL4 A5PLN8 Q9H620 Q9NXT9
Symbols DRE1
KRIP6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23512275 Data show that a miRNA, hsv1-mir-H27, encoded within the genome of herpes simplex virus 1 (HSV-1), targets the mRNA of the cellular transcriptional repressor Kelch-like 24 (KLHL24).
18692513 KRIP6 regulates kainate receptors by inhibiting PICK1 modulation via competition or a mutual blocking effect

AA Sequence

MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVII      1 - 70
CVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKITTENVQYLF     71 - 140
ETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKD    141 - 210
ELIDYICSDELVIGKEEMVFEAVMRWVYRAVDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPE    211 - 280
CYQLLHEARRYHILGNEMMSPRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPE    281 - 350
FTKSEYAVCALRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR    351 - 420
LSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPETNSWLLRAAIPI    421 - 490
AKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMSVCNGKIYILGGRRENGEATD    491 - 560
TILCYDPATSIITGVAAMPRPVSYHGCVTIHRYNEKCFKL                                  561 - 600
//

Text Mined References (8)

PMID Year Title
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23512275 2013 A microRNA encoded by HSV-1 inhibits a cellular transcriptional repressor of viral immediate early and early genes.
18692513 2008 The BTB/kelch protein, KRIP6, modulates the interaction of PICK1 with GluR6 kainate receptors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17254796 2007 KRIP6: a novel BTB/kelch protein regulating function of kainate receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.