Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.11
PubTator Score 2.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.7e-06
psoriasis 6685 1.1e-03
medulloblastoma, large-cell 6234 5.5e-03
Disease Target Count Z-score Confidence
Hepatoblastoma 17 3.453 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 1.7e-06
psoriasis -1.200 1.1e-03
medulloblastoma, large-cell -1.400 5.5e-03

Gene RIF (1)

PMID Text
24067371 CUL3/KLHL22 may contact two distinct motifs within PLK1 protein, consistent with the bivalent mode of substrate targeting.

AA Sequence

MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRHIEAHRILLAA      1 - 70
SCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNVQETLVAACQLQIPEIIHFCC     71 - 140
DFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCE    141 - 210
TEVYEGALLYHYSLEQVQADQISLHEPPKLLETVRFPLMEAEVLQRLHDKLDPSPLRDTVASALMYHRNE    211 - 280
SLQPSLQSPQTELRSDFQCVVGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNF    281 - 350
VYLIGGDNNVQGFRAESRCWRYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYD    351 - 420
PATNSWAYVAPLKREVYAHAGATLEGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGPVRRAWHGMAT    421 - 490
LLNKLYVIGGSNNDAGYRRDVHQVACYSCTSGQWSSVCPLPAGHGEPGIAVLDNRIYVLGGRSHNRGSRT    491 - 560
GYVHIYDVEKDCWEEGPQLDNSISGLAACVLTLPRSLLLEPPRGTPDRSQADPDFASEVMSVSDWEEFDN    561 - 630
SSED                                                                      631 - 634
//

Text Mined References (14)

PMID Year Title
24067371 2013 CUL3 and protein kinases: insights from PLK1/KLHL22 interaction.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23455478 2013 Ubiquitylation-dependent localization of PLK1 in mitosis.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19995937 2009 The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.