Property Summary

NCBI Gene PubMed Count 16
PubMed Score 153.26
PubTator Score 20.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.100 1.1e-02
ependymoma -2.400 6.4e-03
oligodendroglioma -1.800 1.0e-17
glioblastoma -2.200 3.9e-06
medulloblastoma -2.100 1.5e-06
atypical teratoid / rhabdoid tumor -3.300 1.6e-08
medulloblastoma, large-cell -3.200 1.3e-06
primitive neuroectodermal tumor -1.700 2.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.099 6.3e-03
pediatric high grade glioma -1.700 5.0e-06
pilocytic astrocytoma -1.200 4.9e-04
aldosterone-producing adenoma -1.279 1.5e-02
Breast cancer -1.300 6.5e-08
ovarian cancer -1.100 5.1e-03
pituitary cancer -1.100 8.4e-04

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23838290 Co-expression of KLHL2 and Cullin3 decreases the abundance of WNK1, WNK3 and WNK4 within HEK293T cells.
21549840 Results suggest a novel E3 ubiquitin ligase function of KLHL2, with NPCD as a substrate.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15735724 overexpression of Mayven may promote tumor growth through c-Jun and cyclin D1

AA Sequence

METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTIVAEDMEISAH      1 - 70
RVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQVTEENVQVLLPAAGLLQLQD     71 - 140
VKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTYAEQHFADVVLSEEFLNLGIEQVCSLISSDK    141 - 210
LTISSEEKVFEAVIAWVNHDKDVRQEFMARLMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMK    211 - 280
YHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVY    281 - 350
MAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY    351 - 420
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWTYIAEMSTRRSGAG    421 - 490
VGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASV    491 - 560
EYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKPL                                         561 - 593
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
23838290 2013 KLHL2 interacts with and ubiquitinates WNK kinases.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23349464 2013 Structural basis for Cul3 protein assembly with the BTB-Kelch family of E3 ubiquitin ligases.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21549840 2011 Interaction of an intracellular pentraxin with a BTB-Kelch protein is associated with ubiquitylation, aggregation and neuronal apoptosis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16035103 2005 Role of Mayven, a kelch-related protein in oligodendrocyte process formation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15735724 2005 Mayven induces c-Jun expression and cyclin D1 activation in breast cancer cells.
15715669 2005 Process elongation of oligodendrocytes is promoted by the Kelch-related actin-binding protein Mayven.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383316 2004 hDKIR, a human homologue of the Drosophila kelch protein, involved in a ring-like structure.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397770 1999 Characterization of Mayven, a novel actin-binding protein predominantly expressed in brain.