Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.01
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 1.1e-02
posterior fossa group B ependymoma -2.400 1.9e-08
oligodendroglioma -1.400 1.2e-02
glioblastoma -3.400 3.7e-09
medulloblastoma -2.700 3.8e-05
atypical teratoid / rhabdoid tumor -2.200 2.0e-03
pediatric high grade glioma -2.800 1.2e-07
pilocytic astrocytoma -2.700 7.2e-08

Gene RIF (7)

PMID Text
21427078 Renal transplant recipients T carriers of C24T MRP2 with macrolides treatment were associated with reduced mycophenolic acid area under curve in steady-state conditions
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20147652 KLHL1 interacts with Cav3.2 and modulates T-type calcium currents by increasing current deactivation kinetics and current density and calcium influx.
18708037 KLHL1 was expressed in human brain and kidney, but was also in other tissues, such as prostate gland, small intestine, colon, testis (but not the ovaries), liver and pancreas.
18187620 Knockdown of kelch-like 1 (KLHL1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17289272 modulatory effect of KLHL1 on the P/Q-type calcium channel function, suggesting a possible novel role for KLHL1 in cellular excitability.
16982692 This study provides, for the first time, insights into the involvement of MRP2 in neurite outgrowth, which occurs in a GSK3beta-dependent manner.

AA Sequence

MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWGPSQSRLLKSQERSGVSTFWK      1 - 70
KPSSSSSSSSSPSSSSSSFNPLNGTLLPVATRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHE     71 - 140
KGLVLQELKVEPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFRKMESYLKQQQ    141 - 210
LCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLELKED    211 - 280
TIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF    281 - 350
LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAFIRLPLLPPQILADLENHALF    351 - 420
KNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKSTVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAG    421 - 490
MMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLGVTVLEGPIYAVGG    491 - 560
HDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNGKLYSVGGRDGSSCLSSMEYYDPHTNKWNMC    561 - 630
APMCKRRGGVGVATCDGFLYAVGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGD    631 - 700
RLYAVGGYDGQTYLNTMESYDPQTNEWTQMASLNIGRAGACVVVIKQP                          701 - 748
//

Text Mined References (18)

PMID Year Title
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
21427078 2011 Influence of MRP2 on MPA pharmacokinetics in renal transplant recipients-results of the Pharmacogenomic Substudy within the Symphony Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20147652 2010 T-type current modulation by the actin-binding protein Kelch-like 1.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18708037 2008 SCA8 mRNA expression suggests an antisense regulation of KLHL1 and correlates to SCA8 pathology.
17289272 2007 The Kelch-like protein 1 modulates P/Q-type calcium current density.
16982692 2006 KLHL1/MRP2 mediates neurite outgrowth in a glycogen synthase kinase 3beta-dependent manner.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10888605 2000 The SCA8 transcript is an antisense RNA to a brain-specific transcript encoding a novel actin-binding protein (KLHL1).
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.