Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.63
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Hodgkin Disease 16
Disease Target Count P-value
lung carcinoma 2844 3.2e-18
pituitary cancer 1972 1.9e-09
breast carcinoma 1614 3.4e-04
osteosarcoma 7933 4.8e-04
invasive ductal carcinoma 2950 6.5e-03
ductal carcinoma in situ 1745 7.3e-03
Disease Target Count Z-score Confidence
Hodgkin's lymphoma 11 4.006 2.0
Disease Target Count
Lymphoma, Hodgkin, classic 1

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.194 4.8e-04
breast carcinoma -1.200 3.4e-04
lung carcinoma 1.400 3.2e-18
ductal carcinoma in situ -1.100 7.3e-03
invasive ductal carcinoma -1.400 6.5e-03
pituitary cancer 2.100 1.9e-09

Synonym

Accession Q8IXV7
Symbols CHL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
22988245 kelch protein KLHDC8B guards against mitotic errors, centrosomal amplification, and chromosomal instability
20107318 Deficiency of KLHDC8B leads to binucleated cells, implicating its involvement in Reed-Sternberg cell formation
19706467 Depletion of KLHDC8B through RNA interference leads to an increase in binucleated cells, implicating its reduced expression in the formation of classical Hodgkin lymphoma's signature Reed-Sternberg cell.

AA Sequence

MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAETLDMASHTWLALAPLPTARA      1 - 70
GAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTA     71 - 140
PQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIYVLGGRQGKLPVTAFEAFDLEARTWTRHPSLPS    141 - 210
RRAFAGCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRMRDKRADFVVGSLG    211 - 280
GHIVAIGGLGNQPCPLGSVESFSLARRRWEALPAMPTARCSCSSLQAGPRLFVIGGVAQGPSQAVEALCL    281 - 350
RDGV                                                                      351 - 354
//

Text Mined References (10)

PMID Year Title
22988245 2012 The kelch protein KLHDC8B guards against mitotic errors, centrosomal amplification, and chromosomal instability.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20107318 2010 Mutations in a gene encoding a midbody protein in binucleated Reed-Sternberg cells of Hodgkin lymphoma.
19706467 2009 Mutations in a gene encoding a midbody kelch protein in familial and sporadic classical Hodgkin lymphoma lead to binucleated cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.