Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.77
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.582 4.2e-05
juvenile dermatomyositis 3.435 1.9e-12
Atopic dermatitis 1.900 1.4e-02
tuberculosis 1.200 1.2e-04
non-small cell lung cancer 1.050 2.6e-06
interstitial cystitis 3.900 7.5e-03
primary Sjogren syndrome 1.900 7.2e-05
psoriasis 4.000 1.6e-121
breast carcinoma 1.300 6.1e-12
ductal carcinoma in situ 1.600 3.2e-02
invasive ductal carcinoma 1.900 3.7e-03
ovarian cancer 1.200 5.2e-07

Synonym

Accession Q96G42
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20372783 Hs.137007 gene is a novel gene specifically expressed in the breast that has a role in epigenetic regulation of breast cancer [Hs.137007]

AA Sequence

MVLRSHPFPRQDRPQGSVPRAVPGSPVGPSTSTHSEDRHGPSSSVGTVIGTGTGGLVEAGGQPQPRSSET      1 - 70
NGSPSPDPPPGLRGEGTREKSLDPLPQAAMPRGPAQPPAQRPPGPAASSSARRSQPVPQLRKRSRCEIAP     71 - 140
SSEQEVRPAASGDPQGEAPGEGGSPAGRSGALTEKQEEARKLMVFLQRPGGWGVVEGPRKPSSRALEPAT    141 - 210
AAALRRRLDLGSCLDVLAFAQQHGEPGLAQETYALMSDNLLRVLGDPCLYRRLSAADRERILSLRTGRGR    211 - 280
AVLGVLVLPSLYQGGRSGLPRGPRGEEPPAAAPVSLPLPAHLHVFNPRENTWRPLTQVPEEAPLRGCGLC    281 - 350
TMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYSMEC    351 - 420
YDPRTDAWTPRAPLPAGTFPVAHEAVACRGDIYVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSDIVA    421 - 490
LGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQ    491 - 560
FQAKELQPFPLGSTGVLSPFILTLPPEDRLQTSL                                        561 - 594
//

Text Mined References (6)

PMID Year Title
20372783 2010 Hs.137007 is a novel epigenetic marker hypermethylated and up-regulated in breast cancer.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.