Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.77
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis 1.900 1.4e-02
breast carcinoma 1.300 6.1e-12
ductal carcinoma in situ 1.600 3.2e-02
interstitial cystitis 1.300 8.8e-03
invasive ductal carcinoma 1.900 3.7e-03
juvenile dermatomyositis 3.435 1.9e-12
non-small cell lung cancer 1.050 2.6e-06
osteosarcoma -1.582 4.2e-05
ovarian cancer 1.200 5.2e-07
primary Sjogren syndrome 1.900 7.2e-05
psoriasis 1.600 1.4e-24
tuberculosis 1.200 1.2e-04

Gene RIF (1)

AA Sequence

MVLRSHPFPRQDRPQGSVPRAVPGSPVGPSTSTHSEDRHGPSSSVGTVIGTGTGGLVEAGGQPQPRSSET      1 - 70
NGSPSPDPPPGLRGEGTREKSLDPLPQAAMPRGPAQPPAQRPPGPAASSSARRSQPVPQLRKRSRCEIAP     71 - 140
SSEQEVRPAASGDPQGEAPGEGGSPAGRSGALTEKQEEARKLMVFLQRPGGWGVVEGPRKPSSRALEPAT    141 - 210
AAALRRRLDLGSCLDVLAFAQQHGEPGLAQETYALMSDNLLRVLGDPCLYRRLSAADRERILSLRTGRGR    211 - 280
AVLGVLVLPSLYQGGRSGLPRGPRGEEPPAAAPVSLPLPAHLHVFNPRENTWRPLTQVPEEAPLRGCGLC    281 - 350
TMHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMQQARAQLKLVALDGLLYAIGGECLYSMEC    351 - 420
YDPRTDAWTPRAPLPAGTFPVAHEAVACRGDIYVTGGHLFYRLLRYSPVKDAWDECPYSASHRRSSDIVA    421 - 490
LGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQ    491 - 560
FQAKELQPFPLGSTGVLSPFILTLPPEDRLQTSL                                        561 - 594
//

Text Mined References (6)

PMID Year Title