Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.56
PubTator Score 1.83

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy -1.246 2.6e-05
astrocytoma -1.300 8.1e-03
dermatomyositis -1.300 6.9e-03
malignant mesothelioma 1.800 6.9e-07
osteosarcoma 1.081 1.1e-02
Rheumatoid arthritis -1.300 6.9e-03
subependymal giant cell astrocytoma -1.699 4.8e-03

Gene RIF (1)

AA Sequence

LDQSCLPHDIRWELNAMTTNSNISRPIVSSHG                                          351 - 382

Text Mined References (13)

PMID Year Title