Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.75
PubTator Score 5.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.022 2.0e-02
psoriasis -2.900 1.1e-03
osteosarcoma 1.282 1.2e-04
atypical teratoid / rhabdoid tumor 2.100 4.8e-05
glioblastoma 1.300 5.0e-03
medulloblastoma, large-cell -1.400 2.5e-04
pancreatic ductal adenocarcinoma liver m... -1.247 4.6e-02
lung cancer 1.700 4.1e-03
ovarian cancer 1.200 2.2e-04

Gene RIF (1)

PMID Text
23102700 Suggest that Slim/KLHDC10 is an activator of ASK1, contributing to oxidative stress-induced cell death through the suppression of PP5.

AA Sequence

MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKIRWDPVRRRFI      1 - 70
QSCPIIRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGPDNEDYPLFRELWRYHFATGV     71 - 140
WHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESNGNDVHVCNVKYKRWALLSCRGKKPSRIYGQ    141 - 210
AMAIINGSLYVFGGTTGYIYSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTS    211 - 280
WTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQT    281 - 350
FQWVKLPATMPEPVYFHCAAVTPAGCMYIHGGVVNIHENKRTGSLFKIWLVVPSLLELAWEKLLAAFPNL    351 - 420
ANLSRTQLLHLGLTQGLIERLK                                                    421 - 442
//

Text Mined References (8)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
20562859 2010 Network organization of the human autophagy system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962666 2004 Imprinting analysis of 10 genes and/or transcripts in a 1.5-Mb MEST-flanking region at human chromosome 7q32.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.