Property Summary

NCBI Gene PubMed Count 43
PubMed Score 88.79
PubTator Score 59.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (32)

PMID Text
26045791 Suggest role for miR-570/KLF9 molecular network in controlling lung carcinoma progression.
25686501 Palmitic acid increases Ppargamma and Klf6 & Klf9 gene expression and promotes triglyceride accumulation in HepG2 cells.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25641762 The expression of KLF9 is down-regulated in esophageal squamous cell carcinoma and inversely correlated with the clinical features.
25330987 TRs cooperate with KLF9 to regulate hepatocyte proliferation and differentiation and early stages of organogenesis and that TRs exert widespread and important influences on ESC biology.
25313913 Myometrial KLF9 may contribute to the onset of human parturition through its regulation of PGR expression and inflammatory signaling networks.
25305446 Reduced KLF9 expression is associated with glioma.
25288800 Data indicate that integrin alpha6 repression by Kruppel-like factor-9 (KLF9) inhibits glioblastoma cell stemness and tumorigenicity.
25242357 KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression by increasing protein stability.
25217496 increased KLF9 expression is in part responsible for CYP2D6 induction during pregnancy via the potentiation of HNF4alpha transactivation of CYP2D6.
25216959 the expression of KLF9 is up-regulated in human ovarian cancer; KLF9 knockdown significantly inhibited cell proliferation and resulted in cell cycle arrest in the G0/G1 phase
24737412 Data collectively show that KLF9 substantially inhibits AKT activation and abrogates tumor growth of PCa cells.
24613345 Nrf2 amplifies oxidative stress via induction of Klf9.
24173774 We confirmed that PDCD5 overexpression stimulated the promoter activities of KLF9 by luciferase reporter assays.
23865345 Studied mRNA levels of FOXO1, KLF9 and YT521 in human normal and cancerous endometrial tissue. In subjects with endometrial cancer the KLF9 mRNA level (1.12 +/- 0.38) was lower (p < 0.001) when compared to controls (3.11 +/- 1.52).
22711835 Klf9 affects keratinocyte proliferation/differentiation by controlling the expression of target genes in a daytime-dependent manner.
22259059 Loss of KLF9 coregulation of endometrial stromal progesterone receptor-responsive gene networks may underlie progesterone resistance in endometriosis.
22144178 Data identify KLF9 as a novel and potentially clinically relevant transcriptional regulator of drug-induced apoptosis in multiple myeloma cells.
21987111 Expression levels of HOXA11, LIF and BTEB1 mRNA were measured in endometrium during the mid-secretory phase using semi-quantitative RT-PCR
21543766 It was suggested that KLF9 loss-of-expression accompanying endometrial carcinogenesis may predispose endometrial epithelial cells to mechanisms of escape from estrogen-mediated growth regulation, leading to progression of established neoplasms.
21280156 these results show for the first time that KLF9 has differentiating and tumor-suppressing functions in tumor-initiating stem cells.
20463357 homeobox A10(HOXA10) directly and selectively repressed Kruppel-like factor 9 expression in endometrial epithelial cells
20410205 Data support cross-regulation among BMP2, KLF9, and KLF13 to maintain progesterone sensitivity in stromal cells undergoing differentiation and suggest that loss of this network compromises establishment of uterine receptivity and implantation success.
19375645 T3-induced genes identified basic transcription element binding protein 1/Kruppel-like factor 9 (BTEB1/KLF9) and GAR22 as TR target genes
18783612 KLF9 influences the expression of uterine epithelial genes through mechanisms likely involving its transcriptional activator and repressor functions and which may underlie altered tumor biology with aberrant KLF9 expression.
18477211 KLF9 may be involved in the carcinogenesis of human colorectal cancer.
18426912 HNF4alpha regulates thyroid hormone homeostasis through transcriptional regulation of the Dio1 gene with GATA4 and KLF9
18224337 KLF9 did not reveal a otosclerosis-causing mutation
18056793 Transient transfection of Kruppel-like factor 9 suppressed LDLR, steroidogenic acute regulatory protein, and CYP11A
17717078 identify KLF9 as a transcriptional repressor of estrogen receptor alpha signaling
16384861 BTEB1/Progesterone receptor cross-talk to facilitate progesterone dependent gene transcription in endometrial epithelial cells.
8257632 BTEB enhances HIV-1 Tat transactivation of the HIV-1 LTR promoter

AA Sequence

MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDL      1 - 70
NKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASE     71 - 140
KRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEK    141 - 210
RFMRSDHLTKHARRHTEFHPSMIKRSKKALANAL                                        211 - 244
//

Text Mined References (46)

PMID Year Title
26045791 2015 MicroRNA-570 promotes lung carcinoma proliferation through targeting tumor suppressor KLF9.
25686501 2015 The activation of peroxisome proliferator-activated receptor ? is regulated by Krüppel-like transcription factors 6 & 9 under steatotic conditions.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25641762 2016 Krüppel-like factor 9 was down-regulated in esophageal squamous cell carcinoma and negatively regulated beta-catenin/TCF signaling.
25330987 2015 A thyroid hormone receptor/KLF9 axis in human hepatocytes and pluripotent stem cells.
25313913 2015 Prolonged pregnancy in women is associated with attenuated myometrial expression of progesterone receptor co-regulator Krüppel-like Factor 9.
25305446 2015 Krüppel-like factor 9 inhibits glioma cell proliferation and tumorigenicity via downregulation of miR-21.
25288800 2014 Kruppel-like factor-9 (KLF9) inhibits glioblastoma stemness through global transcription repression and integrin ?6 inhibition.
25242357 2014 Transcription factor KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression.
25217496 2014 Krüppel-like factor 9 promotes hepatic cytochrome P450 2D6 expression during pregnancy in CYP2D6-humanized mice.
25216959 2015 Lentivirus-mediated knockdown of Krüppel-like factor 9 inhibits the growth of ovarian cancer.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24737412 2014 KLF9, a transcription factor induced in flutamide-caused cell apoptosis, inhibits AKT activation and suppresses tumor growth of prostate cancer cells.
24613345 2014 Nrf2 amplifies oxidative stress via induction of Klf9.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24173774 2014 The fate of Krüppel-like factor 9-positive hepatic carcinoma cells may be determined by the programmed cell death protein 5.
23865345 2013 The evaluation of the FOXO1, KLF9 and YT521 genes expression in human endometrial cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22711835 2012 Krüppel-like factor 9 is a circadian transcription factor in human epidermis that controls proliferation of keratinocytes.
22344221 2012 Common variants at CDKAL1 and KLF9 are associated with body mass index in east Asian populations.
22259059 2012 Krüppel-like factor 9 and progesterone receptor coregulation of decidualizing endometrial stromal cells: implications for the pathogenesis of endometriosis.
22144178 2012 KLF9 is a novel transcriptional regulator of bortezomib- and LBH589-induced apoptosis in multiple myeloma cells.
21987111 2011 Semi-quantitative analysis of HOXA11, leukemia inhibitory factor and basic transcriptional element binding protein 1 mRNA expression in the mid-secretory endometrium of patients with endometriosis.
21543766 2011 Krüppel-like factor 9 loss-of-expression in human endometrial carcinoma links altered expression of growth-regulatory genes with aberrant proliferative response to estrogen.
21280156 2011 Krüppel-like family of transcription factor 9, a differentiation-associated transcription factor, suppresses Notch1 signaling and inhibits glioblastoma-initiating stem cells.
20463357 2010 HOXA10 inhibits Kruppel-like factor 9 expression in the human endometrial epithelium.
20410205 2010 Functional differentiation of uterine stromal cells involves cross-regulation between bone morphogenetic protein 2 and Kruppel-like factor (KLF) family members KLF9 and KLF13.
19375645 2009 GAR22: a novel target gene of thyroid hormone receptor causes growth inhibition in human erythroid cells.
18783612 2008 The Krüppel-like factor 9 (KLF9) network in HEC-1-A endometrial carcinoma cells suggests the carcinogenic potential of dys-regulated KLF9 expression.
18477211 2008 Downregulation of Krüppel-like factor 9 in human colorectal cancer.
18426912 2008 Hepatocyte nuclear factor 4alpha contributes to thyroid hormone homeostasis by cooperatively regulating the type 1 iodothyronine deiodinase gene with GATA4 and Kruppel-like transcription factor 9.
18224337 2008 A new locus for otosclerosis, OTSC8, maps to the pericentromeric region of chromosome 9.
18056793 2008 Regulation of Kruppel-like factor 4, 9, and 13 genes and the steroidogenic genes LDLR, StAR, and CYP11A in ovarian granulosa cells.
17717078 2007 Kruppel-like factor 9 is a negative regulator of ligand-dependent estrogen receptor alpha signaling in Ishikawa endometrial adenocarcinoma cells.
16384861 2006 Progesterone receptor transactivation of the secretory leukocyte protease inhibitor gene in Ishikawa endometrial epithelial cells involves recruitment of Krüppel-like factor 9/basic transcription element binding protein-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12672823 2003 Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8291025 1993 Chromosomal localization and cDNA sequence of human BTEB, a GC box binding protein.
8269949 1993 Gene structure of CYP3A4, an adult-specific form of cytochrome P450 in human livers, and its transcriptional control.
8257632 1993 Activation of the human immunodeficiency virus type 1 long terminal repeat by BTEB, a GC box-binding transcription factor.
8051167 1994 Cell-specific translational control of transcription factor BTEB expression. The role of an upstream AUG in the 5'-untranslated region.
7775404 1995 Analysis of functional domains of a GC box-binding protein, BTEB.
1356762 1992 Two regulatory proteins that bind to the basic transcription element (BTE), a GC box sequence in the promoter region of the rat P-4501A1 gene.