Property Summary

NCBI Gene PubMed Count 143
PubMed Score 253.62
PubTator Score 240.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Prostate cancer 164 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2388 4.066 2.0

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia 1.300 2.9e-02
acute quadriplegic myopathy 1.021 1.4e-05
aldosterone-producing adenoma -1.340 1.9e-02
astrocytoma 1.700 5.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.322 8.1e-04
Breast cancer -1.200 7.2e-09
breast carcinoma -1.100 2.6e-04
chronic rhinosinusitis -1.423 5.7e-03
cystic fibrosis and chronic rhinosinusit... -1.393 1.7e-02
fibroadenoma -1.200 3.1e-02
gastric cancer -1.300 2.6e-02
glioblastoma 1.500 4.2e-02
group 4 medulloblastoma -1.400 5.4e-04
interstitial lung disease -1.800 1.3e-02
juvenile dermatomyositis 1.043 4.5e-09
lung adenocarcinoma -1.100 3.5e-13
lung cancer -1.400 1.2e-04
lung carcinoma -2.700 1.2e-26
malignant mesothelioma -1.500 4.6e-07
medulloblastoma, large-cell -1.100 4.5e-05
non-small cell lung cancer -1.810 4.1e-23
osteosarcoma -1.607 2.9e-03
ovarian cancer -1.300 3.6e-03
pancreatic cancer -1.300 2.7e-02
pancreatic carcinoma -1.300 2.7e-02
pancreatic ductal adenocarcinoma liver m... 1.571 1.7e-02
pituitary cancer -1.900 3.6e-05
psoriasis -1.800 6.7e-04
Rheumatoid arthritis 1.100 7.2e-03
subependymal giant cell astrocytoma 1.088 2.3e-02

 GWAS Trait (1)

Gene RIF (133)

AA Sequence

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILA      1 - 70
REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKL     71 - 140
SSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKV    141 - 210
YTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMK    211 - 280
RHL                                                                       281 - 283
//

Text Mined References (144)

PMID Year Title