Property Summary

NCBI Gene PubMed Count 136
PubMed Score 189.70
PubTator Score 139.18

Knowledge Summary

Patent

No data available

Expression

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1700 screening 672 / 0 / 290221 Primary cell-based high throughput screening assay to identify inhibitors of kruppel-like factor 5 (KLF5)
1834 screening 484 / 0 / 126 Luminescence-based confirmation cell-based high throughput screening assay to identify inhibitors of kruppel-like factor 5 (KLF5)
1858 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of kruppel-like factor 5 (KLF5)
1973 confirmatory 119 / 0 / 3 Luminescence-based dose response cell-based high throughput screening assay for inhibitors of kruppel-like factor 5 (KLF5).
2750 confirmatory 24 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5
434957 confirmatory 13 / 0 / 24 Late stage results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): luminescence-based cell-based dose response assay for inhibitors of KLF5 (Round 1)
485336 confirmatory 2 / 0 / 5 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels
588539 other 3 / 0 / 0 Late stage assay provider counterscreen results for the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Cell cycle analysis of the DLD-1 cell line
588617 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels in DLD1 cells
588652 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of KLF5 protein levels in HCT116 human colorectal carcinoma cells
More...

Gene RIF (106)

PMID Text
26792671 We provide the first evidence that the expression of KLF5 is up-regulated in small airways and pulmonary vessels of patients with COPD and may be involved in the tissue remodeling of COPD.
26786295 Data suggest both KLF5 and FYN (FYN proto-oncogene) are important in regulation of migration in bladder cancer cells; KLF5 up-regulates cell migration, lamellipodia formation, expression of FYN, and phosphorylation of FAK (focal adhesion kinase).
26544730 our results indicate that KLF5 promotes angiogenesis of bladder cancer through directly regulating VEGFA transcription
26483416 that estrogen biphasically modulates prostate tumor formation by regulating Kruppel-like zinc finger transcription factor 5-dependent transcription through estrogen receptor beta
26474386 Data indicate direct binding of microRNA miR-375 to the 3'-untranslated region of transcription factor KLF5.
26419610 BAP1 interacts directly with KLF5 and stabilizes KLF5 via deubiquitination.
26397390 ABL-N administration induced apoptosis of PC3 cells in a dose-dependent manner, along with the enhanced activity of caspases and increased Bax/Bcl-2 ratio. Expression of KLF5, Stat5b and ICAM-1 was significantly downregulated in PC3 cells.
26189798 findings collectively suggest that TNFAIP2 is a direct KLF5 target gene, and both KLF5 and TNFAIP2 promote breast cancer cell proliferation, migration and invasion through Rac1 and Cdc42
26097551 down-regulation of KLF4 and up-regulation of KLF5 may stimulate oral carcinoma progression through the dedifferentiation of carcinoma cells.
26079537 ATXN3L has a role in the regulation of KLF5 stability in breast cancer
26077572 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25970772 TEAD4 and KLF5, in collaboration, promoted triple negative breast cancer cell proliferation and tumor growth in part by inhibiting p27 gene transcription
25896712 KLF5 loss enhances tumor angiogenesis by attenuating PI3K/AKT signaling and subsequent accumulation of HIF1alpha in PTEN deficient prostate tumors.
25789974 These results identify KLF4 and KLF5 as cooperating protumorigenic factors and critical participants in resistance to lapatinib, furthering the rationale for combining anti-MCL1/BCL-XL inhibitors with conventional HER2-targeted therapies.
25683913 KLF5 facilitates lysophosphatidic acid -induced interaction between beta-catenin and TCF4.
25504335 Simultaneous downregulation of KLF5 and Fli1 is a key feature underlying systemic sclerosis.
25197166 study results indicate that KLF5 mediates proinflammatory cytokine expression through upregulation of NF-kappaB phosphorylation at p65 in LPS-induced ALI.
25119587 KLF5 mRNA overexpression is associated with cervical cancer.
25053715 KLF5/GATA4/GATA6 may promote gastric cancer development by engaging in mutual crosstalk, collaborating to maintain a pro-oncogenic transcriptional regulatory network in gastric cancer cells.
25051115 Using small interfering RNA (siRNA) targeting KLF5 or HIF-1alpha, study demonstrated that KLF5 or HIF-1alpha knockdown inhibited hypoxia-induced cell survival and promoted cell apoptosis by actively downregulating cyclin B1, survivin and upregulating caspase-3 in lung cancer cells.
25037223 Data indicate that histone deacetylase inhibitors (HDACi) induce intestinal alkaline phosphatase (ALPi) in a subset of colon cancer cell lines in a Kruppel-like factor 5 (KLF5)-dependent manner.
25023776 Unfractionated heparin suppresses lipopolysaccharide-induced monocyte chemoattractant protein-1 expression in human microvascular endothelial cells by blocking Kruppel-like factor 5 and nuclear factor-kappaB pathway
24931571 deacetylation switched KLF5 to tumor promoting activity, and blocking TGFbeta signaling attenuated the tumor suppressor activity of KLF5
24584857 Altogether, our data provide an explanation for low HK3 and KLF5 expression in particular AML subtype and establish these genes as novel CEBPA targets during neutrophil differentiation.
24401325 KLF5/Sox4 regulatory signaling play an important role in lung tumorigenesis, which might represent novel therapeutic targets to manage lung carcinoma.
24398687 amino acid residue 301 of KLF5 is critical for proper recognition of the phosphodegron sequence by FBW7alpha and that the P301S mutation inhibits this recognition
24323942 The differential roles of KLF5 in particular tissues and cancer states. [Review]
24126055 KLF5 maintains epithelial characteristics and prevents EMT by transcriptionally activating the miR-200 family in epithelial cells.
23975368 Kruppel-like factor 5: a novel biomarker for lymph node metastasis and recurrence in supraglottic squamous cell laryngeal carcinoma.
23913682 mPGES1 is a target gene of KLF5 in human breast cancer celsl
23880760 These results identify KLF5 as a transactivator of HIF-1alpha and show that LPA regulates HIF-1alpha by dynamically modulating its interaction with KLF5 and p53.
23869764 KLF5 was highly expressed in the ovarian cancer cell line.
23810009 Data suggest that KLF5 activity is regulated by progesterone/estrogen in normal mammary gland and in breast cancer; KLF5 participates in estrogen/estrogen receptor and progesterone/progesterone receptor signaling and breast tumorigenesis. [REVIEW]
23633919 KLF5 activation of JNK signaling is mediated by KLF5 transactivation of two key upstream regulators of the JNK pathway, ASK1 and MKK4.
23372710 Helicobacter pylori promotes the expression of KLF5, a mediator of carcinogenesis, in vitro and in vivo.
23112162 SALL4 and KLF5 were aberrantly expressed in the CDX1(+) intestinal metaplasia of the stomach. Sustained expression of CDX1 gave rise to the induction of early intestinal-stemness markers, followed by the expression of intestinal-differentiation markers.
22990386 The KLF5 directly and diffentially bound to p21Waf1/Cip1 in the presence or absence of mutant p53.
22936544 KLF5 is an androgen-responsive gene in breast carcinomas, which plays an important role in progression and is considered a potent prognostic factor in human breast cancers.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of Kruppel-like factor 5 (KLF5) in U-937 macrophages
22584587 KLF5 reverses hhLIM function from anti-proliferation to pro-proliferation through its interaction with hhLIM on the cyclin E promoter.
22120375 KLF5 is highly expressed in large and giant unruptured aneurysms and that in ruptured aneurysmal wall KLF5 expression was scarce.
22094285 the expression of KLF5 and MMP-9 may be involved in cartilage degeneration, contributing to human osteoarthritis
22045023 TAZ promotes breast cell growth partially through protecting KLF5 from WWP1-mediated degradation and enhancing KLF5's activities.
21993314 The granulocyte-associated transcription factor Kruppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.
21953463 SMURF2 is a novel E3 ubiquitin ligase for KLF5 and negatively regulates KLF5 by targeting it for proteasomal degradation.
21951574 KLF5 is activated in human pulmonary arterial hypertension and implicated in the pro-proliferative and anti-apoptotic phenotype that characterizes pulmonary arterial hypertension.
21868761 KLF5 transactivates NOTCH1 in the context of p53 mutation or loss. KLF5 loss limited NOTCH1 activity and was sufficient on its own to transform primary human keratinocytes harboring mutant p53, leading to the formation of invasive tumors.
21732124 KLF5 may play an oncogenetic role in gastric carcinogenesis.
21674249 Loss of nuclear expression of KLF5 is associated with in situ and invasive breast carcinomas.
21566082 KLF5 is a progesterone-induced gene that contributes to progesterone-mediated breast epithelial cell proliferation and dedifferentiation
21487105 Data show that results demonstrate that estrogens and antiestrogens affect prostate tumor growth through ERbeta-mediated regulation of KLF5.
21470678 Low KLF5 is associated with acute myeloid leukemia.
20639455 while KLF5 is not required for oncogenic mutant K-Ras-induced lung tumorigenesis, KLF5 regulation of ABCG2 expression may be important for chemotherapeutic resistance and patient survival.
20484041 Endogenous Fbw7 suppresses the FGF-BP gene expression and breast cell proliferation through targeting KLF5 for degradation.
20388706 Fbw7 is a key negative regulator controlling KLF5-mediated cell proliferation; there may be a mechanism linking the loss of Fbw7 function to tumorigenesis
20086047 Single nucleotide polymorphisms in the KLF5 gene is associated with hypertension.
20086047 Observational study of gene-disease association. (HuGE Navigator)
19684017 These results suggest that KLF5 is not only essential for MYC transcription in proliferating epithelial cells but also mediates the inhibitory effect of TGFbeta on MYC transcription.
19671674 KLF5 is overexpressed in pancreatic cancer cells and exceeds KLF5 expression of KRAS-mutated colon cancer cells.
19668233 KLF5 may promote breast cancer cell proliferation at least partially through directly activating the FGF-BP mRNA transcription.
19569049 results suggest that KLF5 inhibits the function of ERalpha in gene regulation and cell proliferation through protein interaction that interrupts the binding of ERalpha to target gene promoters to prevent target gene induction
19460858 AR can utilize the CXCL12/CXCR4 axis through induction of KLF5 expression to promote prostate cancer progression
19448973 KLF5 mediates the signaling functions in cell proliferation, cell cycle, apoptosis, migration, differentiation, and stemness by regulating gene expression in response to environment stimuli. [review]
19419955 Activation of TGFbeta recruits p300 to the KLF5-Smad complex to acetylate KLF5, and the complex with acetylated KLF5 binds to the Smad binding element and alters the binding of other factors to p15 promoter to induce its transcription
19056724 TGFbeta recruited acetylase p300 to acetylate KLF5, and acetylation in turn altered the binding of KLF5 to p15 promoter, resulting in the reversal of KLF5 function.
18782761 nuclear export signal in KLF5 directs a fused green fluorescence protein to the cytoplasm
18774944 Results suggest that the FASN gene is activated by the synergistic action of KLF5 and SREBP-1, which was induced by androgen in androgen-dependent prostate cancer cells.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18617520 KLF5 causes cartilage matrix degradation through transcriptional induction of MMP9, providing the first evidence that transcriptional regulation of a proteinase contributes to endochondral ossification and skeletal development.
18226501 These findings suggest that the KLF5 gene is a novel schizophrenia-susceptibility gene, and that the expression of the gene is involved in the pathophysiology of schizophrenia via glutamatergic neurotransmission.
18226501 Observational study of gene-disease association. (HuGE Navigator)
18054006 This study reports that KLF5 is an important downstream mediator for the transforming effect of activated KRAS in intestinal epithelial cells and colorectal cancer.
18039846 recruitment of ANP32B onto the promoter region requires KLF5 and results in promoter region-specific histone incorporation and inhibition of histone acetylation by ANP32B
17688680 Observational study of gene-disease association. (HuGE Navigator)
17688680 analysis of SNPs, located in the KLF2, KLF4 and KLF5 gene did not show an association with Type 2 diabetes in this French population
17603560 Plays an important role in modulating apoptosis secondary to DNA damage through a p53-independent pathway
17508399 A review article that describes the biological and pathobiological functions in the intestinal epithelium.
17430902 KLF5 as a target of lysophosphatidic acid mediated signaling and suggest a role of KLF5 in promoting proliferation of intestinal epithelia in response to lysophosphatidic acid .
17320083 KLF5 protein degradation is blocked by an N-terminal FLAG tag or a small N-terminal deletion without reducing ubiquitination and degradation mediated by WWP1.
17178721 This study examines the physical interaction between KLF5 and protein inhibitor of activated STAT 1 (PIAS1) which enhances KLF5's pro-proliferative activity.
16638850 Patients with higher KLF5 expression have shorter disease-free survival and overall survival than patients with lower KLF5 expression.
16595680 analysis of a novel regulatory pathway for the expression of survivin under the control of KLF5 and p53
16500892 This study describes that KLF5 is an important downstream mediator for the pro-inflammatory activity of NF-kB in intestinal epithelial cells.
16341264 KLF2 is a transcription factor important in the integration of multiple endothelial functions associated with regions of the arterial vasculature that are relatively resistant to atherogenesis.
16223724 KLF5 is a target of the E3 ubiquitin ligase WWP1 for proteolysis in epithelial cells
16102754 This study reports that KLF5 is activated by oncogenic HRAS and that activated KLF5 promotes mitosis by inducing transcription of the cyclin B1 and Cdc2 genes.
16102021 KLF5 is an essential transcription factor in cardiovascular remodeling (review)
16054042 KLF5 is a key component of the transcription factor network controlling adipocyte differentiation
16023392 In co-transfection assays in K562 cells, it was demonstrated that KLF2, 5 and 13 positively regulate, and KLF8 negatively regulates, the gamma-globin gene through the CACCC promoter element.
15937668 Observational study of gene-disease association. (HuGE Navigator)
15740636 This is an review article that summarizes the function of KLF4 and KLF5 in regulating cell proliferation.
15735697 KLF5 protein is degraded at least in part through ubiquitination-proteasome pathway, which may have become hyperactive for KLF5 in cancer cells
15668237 HDAC1 negatively regulates the cardiovascular transcription factor KLF5 through direct interaction
15581624 This study describes that the inhibitory effect of all-trans retinoic acid (ATRA) on proliferation of intestinal epithelial cells is a result of ATRA-mediated expression of KLF5.
15581624 Results indicate that Kruppel-like factor 5 is a potential mediator for the inhibitory effect of all-trans retinoid acid on intestinal epithelial cell proliferation.
15077182 KLF5 mediates the transforming effect of oncogenic H-Ras in NIH3T3 fibroblast cells and does so by transactivating the cyclin D1 promoter
14726538 intestinal tumor progression is associated with a change in the growth-related functions of KLF5
14612398 Positive and negative regulation of the cardiovascular transcription factor KLF5 by p300 and the oncogenic regulator SET through interaction and acetylation on the DNA-binding domain.
14587307 BTEB2, a zinc finger transcription factor, may contribute to the establishment of the choroidal neovascularization observed in the pathogenesis of age-related macular degeneration and idiopathic choroidal neovascularization
14573617 KLF5 and p50 are important for induction of PDGF-A chain.
12901861 KLF4, but not KLF5, was frequently downregulated in bladder cancer cell lines and cancer tissues.
12661032 Gene deletion and loss of expression and cell growth suppression indicate that KLF5 may be tumor suppressor gene at 13q21 in prostate cancer. Mutation and promoter methylation do not commonly inactivate KLF5 in prostate cancer.
12576331 KLF5 bound and efficiently transactivated the TCR Dbeta1 promoter
12242654 KLF5 suppresses tumor cell growth in breast cancer.
12087155 This study describes the opposite effect of KLF4 and KLF5 on transcription of the KLF4 gene.
11152667 Overexpression of KLF5 in transfected cells led to increased cell proliferation including foci formation and anchorage-independent growth in a manner consistent with a transformed phenotype.

AA Sequence

MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQP      1 - 70
AQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFL     71 - 140
PDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQ    141 - 210
ELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQG    211 - 280
MPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVN    281 - 350
SQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL    351 - 420
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN                                     421 - 457
//

Text Mined References (139)

PMID Year Title
26792671 2016 Possible role of Krüppel-like factor 5 in the remodeling of small airways and pulmonary vessels in chronic obstructive pulmonary disease.
26786295 2016 KLF5 promotes cell migration by up-regulating FYN in bladder cancer cells.
26544730 2015 Beyond proliferation: KLF5 promotes angiogenesis of bladder cancer through directly regulating VEGFA transcription.
26483416 2016 Estrogen Exhibits a Biphasic Effect on Prostate Tumor Growth through the Estrogen Receptor ?-KLF5 Pathway.
26474386 2015 Potential involvement of miR-375 in the premalignant progression of oral squamous cell carcinoma mediated via transcription factor KLF5.
26419610 2015 BAP1 promotes breast cancer cell proliferation and metastasis by deubiquitinating KLF5.
26397390 2015 ABL-N may induce apoptosis of human prostate cancer cells through suppression of KLF5, ICAM-1 and Stat5b, and upregulation of Bax/Bcl-2 ratio: An in vitro and in vivo study.
26189798 2016 KLF5 promotes breast cancer proliferation, migration and invasion in part by upregulating the transcription of TNFAIP2.
26097551 2015 Krüppel-like factors 4 and 5 expression and their involvement in differentiation of oral carcinomas.
26079537 2015 Ataxin-3 like (ATXN3L), a member of the Josephin family of deubiquitinating enzymes, promotes breast cancer proliferation by deubiquitinating Krüppel-like factor 5 (KLF5).
26077572 2015 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25970772 2015 The interplay between TEAD4 and KLF5 promotes breast cancer partially through inhibiting the transcription of p27Kip1.
25896712 2015 KLF5 inhibits angiogenesis in PTEN-deficient prostate cancer by attenuating AKT activation and subsequent HIF1? accumulation.
25789974 2015 Regulation of anti-apoptotic signaling by Kruppel-like factors 4 and 5 mediates lapatinib resistance in breast cancer.
25683913 2015 Krüppel-like factor 5 incorporates into the ?-catenin/TCF complex in response to LPA in colon cancer cells.
25504335 2014 Simultaneous downregulation of KLF5 and Fli1 is a key feature underlying systemic sclerosis.
25197166 2014 Krüppel-like factor 5 mediates proinflammatory cytokine expression in lipopolysaccharide-induced acute lung injury through upregulation of nuclear factor-?B phosphorylation in vitro and in vivo.
25119587 2014 Krüppel-like factor 5 as potential molecular marker in cervical cancer and the KLF family profile expression.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25053715 2015 Regulatory crosstalk between lineage-survival oncogenes KLF5, GATA4 and GATA6 cooperatively promotes gastric cancer development.
25051115 2014 KLF5 promotes hypoxia-induced survival and inhibits apoptosis in non-small cell lung cancer cells via HIF-1?.
25037223 2014 The intestinal epithelial cell differentiation marker intestinal alkaline phosphatase (ALPi) is selectively induced by histone deacetylase inhibitors (HDACi) in colon cancer cells in a Kruppel-like factor 5 (KLF5)-dependent manner.
25023776 2014 Unfractionated heparin suppresses lipopolysaccharide-induced monocyte chemoattractant protein-1 expression in human microvascular endothelial cells by blocking Krüppel-like factor 5 and nuclear factor-?B pathway.
24931571 2015 Interruption of KLF5 acetylation converts its function from tumor suppressor to tumor promoter in prostate cancer cells.
24584857 2014 CEBPA-dependent HK3 and KLF5 expression in primary AML and during AML differentiation.
24401325 2014 Krüppel-like factor 5 promotes lung tumorigenesis through upregulation of Sox4.
24398687 2014 A colon cancer-derived mutant of Krüppel-like factor 5 (KLF5) is resistant to degradation by glycogen synthase kinase 3? (GSK3?) and the E3 ubiquitin ligase F-box and WD repeat domain-containing 7? (FBW7?).
24323942 2013 The double life of KLF5: Opposing roles in regulation of gene-expression, cellular function, and transformation.
24126055 2013 KLF5 activates microRNA 200 transcription to maintain epithelial characteristics and prevent induced epithelial-mesenchymal transition in epithelial cells.
23975368 2014 Krüppel-like factor 5: a novel biomarker for lymph node metastasis and recurrence in supraglottic squamous cell laryngeal carcinoma.
23913682 2013 Kruppel-like factor 5 transcription factor promotes microsomal prostaglandin E2 synthase 1 gene transcription in breast cancer.
23880760 2013 Regulation of hypoxia-inducible factor 1? (HIF-1?) by lysophosphatidic acid is dependent on interplay between p53 and Krüppel-like factor 5.
23869764 2013 KLF5 strengthens drug resistance of ovarian cancer stem-like cells by regulating survivin expression.
23810009 2013 Role of KLF5 in hormonal signaling and breast cancer development.
23633919 2013 Restoring KLF5 in esophageal squamous cell cancer cells activates the JNK pathway leading to apoptosis and reduced cell survival.
23521344 2013 Methylation of KLF5 contributes to reduced expression in acute myeloid leukaemia and is associated with poor overall survival.
23372710 2013 Helicobacter pylori promotes the expression of Krüppel-like factor 5, a mediator of carcinogenesis, in vitro and in vivo.
23134681 2013 Shaking the family tree: identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors.
23112162 2012 CDX1 confers intestinal phenotype on gastric epithelial cells via induction of stemness-associated reprogramming factors SALL4 and KLF5.
22990386 2012 p53 mutation alters the effect of the esophageal tumor suppressor KLF5 on keratinocyte proliferation.
22936544 2012 Krüppel-like factor 5 in human breast carcinoma: a potent prognostic factor induced by androgens.
22632819 2012 YAP promotes breast cell proliferation and survival partially through stabilizing the KLF5 transcription factor.
22584587 2012 KLF5 and hhLIM cooperatively promote proliferation of vascular smooth muscle cells.
22120375 2012 Krüppel-like zinc-finger transcription factor 5 (KLF5) is highly expressed in large and giant unruptured cerebral aneurysms.
22094285 2012 Clinicopathological correlation of Krüppel-like factor 5 and matrix metalloproteinase-9 expression and cartilage degeneration in human osteoarthritis.
22045023 2012 TAZ antagonizes the WWP1-mediated KLF5 degradation and promotes breast cell proliferation and tumorigenesis.
21993314 2012 The granulocyte-associated transcription factor Krüppel-like factor 5 is silenced by hypermethylation in acute myeloid leukemia.
21953463 2011 The E3 ubiquitin ligase SMAD ubiquitination regulatory factor 2 negatively regulates Krüppel-like factor 5 protein.
21951574 2011 Krüppel-like factor 5 contributes to pulmonary artery smooth muscle proliferation and resistance to apoptosis in human pulmonary arterial hypertension.
21885866 2011 Identification of small-molecule inhibitors of the colorectal cancer oncogene Krüppel-like factor 5 expression by ultrahigh-throughput screening.
21868761 2011 Loss of transcription factor KLF5 in the context of p53 ablation drives invasive progression of human squamous cell cancer.
21732124 2011 Expression of Kr?ppel-like factor 5 in gastric cancer and its clinical correlation in Taiwan.
21674249 2012 Association of expression of kruppel-like factor 4 and kruppel-like factor 5 with the clinical manifestations of breast cancer.
21566082 2011 The induction of KLF5 transcription factor by progesterone contributes to progesterone-induced breast cancer cell proliferation and dedifferentiation.
21542805 2011 Oestrogen causes degradation of KLF5 by inducing the E3 ubiquitin ligase EFP in ER-positive breast cancer cells.
21487105 2011 Estrogen regulates tumor growth through a nonclassical pathway that includes the transcription factors ER? and KLF5.
21470678 2011 Deregulated expression of Kruppel-like factors in acute myeloid leukemia.
20639455 2010 Kruppel-like factor 5 is not required for K-RasG12D lung tumorigenesis, but represses ABCG2 expression and is associated with better disease-specific survival.
20484041 2010 The Fbw7 tumor suppressor targets KLF5 for ubiquitin-mediated degradation and suppresses breast cell proliferation.
20388706 2010 The Fbw7/human CDC4 tumor suppressor targets proproliferative factor KLF5 for ubiquitination and degradation through multiple phosphodegron motifs.
20101243 2010 A genome-wide association study identifies pancreatic cancer susceptibility loci on chromosomes 13q22.1, 1q32.1 and 5p15.33.
20086047 2010 Regulatory polymorphism in transcription factor KLF5 at the MEF2 element alters the response to angiotensin II and is associated with human hypertension.
19684017 2009 Opposing effects of KLF5 on the transcription of MYC in epithelial proliferation in the context of transforming growth factor beta.
19671674 2009 Up-regulation of Krüppel-like factor 5 in pancreatic cancer is promoted by interleukin-1beta signaling and hypoxia-inducible factor-1alpha.
19668233 2009 Krüppel-like factor 5 promotes breast cell proliferation partially through upregulating the transcription of fibroblast growth factor binding protein 1.
19628677 2009 Angiotensin II stimulates KLF5 phosphorylation and its interaction with c-Jun leading to suppression of p21 expression in vascular smooth muscle cells.
19569049 2010 Estrogen-induced interaction between KLF5 and estrogen receptor (ER) suppresses the function of ER in ER-positive breast cancer cells.
19460858 2009 Induction of Kruppel-like factor 5 expression by androgens results in increased CXCR4-dependent migration of prostate cancer cells in vitro.
19448973 2009 Essential role of KLF5 transcription factor in cell proliferation and differentiation and its implications for human diseases.
19419955 2009 Acetylation of KLF5 alters the assembly of p15 transcription factors in transforming growth factor-beta-mediated induction in epithelial cells.
19411256 2009 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
19366898 2009 Enhanced expression of mRNA for Kruppel-like factor 5 in CD34+ cells of the bone marrow in rheumatoid arthritis.
19240162 2009 Identification of novel small-molecule compounds that inhibit the proproliferative Kruppel-like factor 5 in colorectal cancer cells by high-throughput screening.
19189969 2009 Kruppel-like factor 5 shows proliferation-specific roles in vascular remodeling, direct stimulation of cell growth, and inhibition of apoptosis.
19056724 2009 Pro-proliferative factor KLF5 becomes anti-proliferative in epithelial homeostasis upon signaling-mediated modification.
18782761 2008 SUMOylation regulates nuclear localization of Krüppel-like factor 5.
18774944 2009 KLF5 enhances SREBP-1 action in androgen-dependent induction of fatty acid synthase in prostate cancer cells.
18670098 2008 Inhibition of monocyte chemoattractant protein-1 by Krüppel-like factor 5 small interfering RNA in the tumor necrosis factor- alpha-activated human umbilical vein endothelial cells.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18617520 2008 Kruppel-like factor 5 causes cartilage degradation through transactivation of matrix metalloproteinase 9.
18599506 2008 Kruppel-like factor 5 is required for perinatal lung morphogenesis and function.
18500350 2008 SUMOylation of Krüppel-like transcription factor 5 acts as a molecular switch in transcriptional programs of lipid metabolism involving PPAR-delta.
18226501 2008 Expression of Kruppel-like factor 5 gene in human brain and association of the gene with the susceptibility to schizophrenia.
18054006 2008 Krüppel-like factor 5 mediates cellular transformation during oncogenic KRAS-induced intestinal tumorigenesis.
18039846 2008 Promoter region-specific histone incorporation by the novel histone chaperone ANP32B and DNA-binding factor KLF5.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17688680 2007 Analysis of KLF transcription factor family gene variants in type 2 diabetes.
17622557 2008 Expression of Krüppel-like factor 5 in human gastric carcinomas.
17603560 2008 Kruppel-like factor 5 modulates p53-independent apoptosis through Pim1 survival kinase in cancer cells.
17508399 2007 The diverse functions of Krüppel-like factors 4 and 5 in epithelial biology and pathobiology.
17430902 2007 Lysophosphatidic acid facilitates proliferation of colon cancer cells via induction of Krüppel-like factor 5.
17320083 2007 Proteasomal degradation of the KLF5 transcription factor through a ubiquitin-independent pathway.
17283079 2007 Functional interaction between the transcription factor Krüppel-like factor 5 and poly(ADP-ribose) polymerase-1 in cardiovascular apoptosis.
17178721 2007 Protein inhibitor of activated STAT1 interacts with and up-regulates activities of the pro-proliferative transcription factor Krüppel-like factor 5.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16904982 2006 Angiotensin II and tumor necrosis factor-alpha upregulate survivin and Kruppel-like factor 5 in smooth muscle cells: Potential relevance to vein graft hyperplasia.
16638850 2006 Expression of KLF5 is a prognostic factor for disease-free survival and overall survival in patients with breast cancer.
16595680 2006 KLF5 Interacts with p53 in regulating survivin expression in acute lymphoblastic leukemia.
16500892 2006 Kruppel-like factor 5 is an important mediator for lipopolysaccharide-induced proinflammatory response in intestinal epithelial cells.
16357509 2005 KLF4 and KLF5 regulate proliferation, apoptosis and invasion in esophageal cancer cells.
16341264 2006 Integration of flow-dependent endothelial phenotypes by Kruppel-like factor 2.
16223724 2005 Human Kruppel-like factor 5 is a target of the E3 ubiquitin ligase WWP1 for proteolysis in epithelial cells.
16184550 2006 KLF5 promotes cell proliferation and tumorigenesis through gene regulation and the TSU-Pr1 human bladder cancer cell line.
16102754 2005 Krüppel-like factor 5 promotes mitosis by activating the cyclin B1/Cdc2 complex during oncogenic Ras-mediated transformation.
16102021 2005 Significance of the transcription factor KLF5 in cardiovascular remodeling.
16054042 2005 Krüppel-like transcription factor KLF5 is a key regulator of adipocyte differentiation.
16023392 A functional screen for Krüppel-like factors that regulate the human gamma-globin gene through the CACCC promoter element.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15740636 2005 Krüppel-like factors 4 and 5: the yin and yang regulators of cellular proliferation.
15735697 2005 Ubiquitin-proteasome degradation of KLF5 transcription factor in cancer and untransformed epithelial cells.
15668237 2005 The deacetylase HDAC1 negatively regulates the cardiovascular transcription factor Krüppel-like factor 5 through direct interaction.
15581624 2004 All-trans retinoic acid inhibits proliferation of intestinal epithelial cells by inhibiting expression of the gene encoding Kruppel-like factor 5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15098654 2003 KLF5/BTEB2, a Krüppel-like zinc-finger type transcription factor, mediates both smooth muscle cell activation and cardiac hypertrophy.
15087132 2004 Regulation of KLF5 involves the Sp1 transcription factor in human epithelial cells.
15077182 2004 Krüppel-like factor 5 mediates the transforming activity of oncogenic H-Ras.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14726538 2004 Intestinal tumor progression is associated with altered function of KLF5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612398 2003 Positive and negative regulation of the cardiovascular transcription factor KLF5 by p300 and the oncogenic regulator SET through interaction and acetylation on the DNA-binding domain.
14587307 Immunohistochemical study of surgically excised choroidal neovascular membranes.
14573617 2004 Regulation of platelet-derived growth factor-A chain by Krüppel-like factor 5: new pathway of cooperative activation with nuclear factor-kappaB.
14557694 2003 Smooth muscle cell outgrowth from coronary atherectomy specimens in vitro is associated with less time to restenosis and expression of a key Transcription factor KLF5/BTEB2.
12901861 2003 Downregulation and growth inhibitory effect of epithelial-type Krüppel-like transcription factor KLF4, but not KLF5, in bladder cancer.
12682370 2003 Phosphorylation of Kruppel-like factor 5 (KLF5/IKLF) at the CBP interaction region enhances its transactivation function.
12661032 2003 KLF5 is frequently deleted and down-regulated but rarely mutated in prostate cancer.
12576331 2003 Regulation of T-cell receptor D beta 1 promoter by KLF5 through reiterated GC-rich motifs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242654 2002 A possible tumor suppressor role of the KLF5 transcription factor in human breast cancer.
12113473 2002 Human Krüppel-like factor5/KLF5: synergy with NF-kappaB/Rel factors and expression in human skin and hair follicles.
12101409 2002 Krüppel-like zinc-finger transcription factor KLF5/BTEB2 is a target for angiotensin II signaling and an essential regulator of cardiovascular remodeling.
12087155 2002 Opposing effects of Krüppel-like factor 4 (gut-enriched Krüppel-like factor) and Krüppel-like factor 5 (intestinal-enriched Krüppel-like factor) on the promoter of the Krüppel-like factor 4 gene.
11152667 2001 Intestinal-enriched Krüppel-like factor (Krüppel-like factor 5) is a positive regulator of cellular proliferation.
11076828 2000 Regulated expression of the BTEB2 transcription factor in vascular smooth muscle cells: analysis of developmental and pathological expression profiles shows implications as a predictive factor for restenosis.
10572182 1999 Isolation and characterization of a gene encoding human Kruppel-like factor 5 (IKLF): binding to the CAAT/GT box of the mouse lactoferrin gene promoter.
9973612 1999 A gene encoding an intestinal-enriched member of the Krüppel-like factor family expressed in intestinal epithelial cells.
9089417 1997 Transcriptional activation domain of human BTEB2, a GC box-binding factor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8479902 1993 cDNA cloning and transcriptional properties of a novel GC box-binding protein, BTEB2.