Property Summary

NCBI Gene PubMed Count 254
PubMed Score 682.63
PubTator Score 473.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Meningioma 27 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.067 2.5
Atherosclerosis 275 3.031 1.5

Expression

  Differential Expression (38)

Disease log2 FC p
Rheumatoid Arthritis 1.300 5.3e-03
gastric cancer -1.800 3.4e-03
pancreatic cancer 2.100 1.9e-02
psoriasis -1.600 1.3e-03
chronic lymphosyte leukemia -1.500 3.5e-03
group 4 medulloblastoma -2.900 8.9e-06
astrocytoma 2.100 4.6e-02
glioblastoma 1.300 4.2e-02
medulloblastoma, large-cell -2.700 1.7e-03
autosomal dominant Emery-Dreifuss muscul... 2.209 1.9e-02
fascioscapulohumeral muscular dystrophy 1.498 8.9e-03
juvenile dermatomyositis 1.250 8.0e-04
acute quadriplegic myopathy 1.723 1.1e-02
Atopic dermatitis -1.800 9.6e-04
adrenocortical carcinoma -2.182 2.8e-04
tuberculosis 2.100 1.3e-04
primary pancreatic ductal adenocarcinoma 2.275 2.5e-02
non-small cell lung carcinoma -1.900 1.5e-19
intraductal papillary-mucinous adenoma (... 2.600 4.2e-04
intraductal papillary-mucinous carcinoma... 2.200 1.7e-03
intraductal papillary-mucinous neoplasm ... 2.500 7.2e-03
colon cancer -2.800 6.1e-04
lung cancer -2.100 1.9e-05
breast carcinoma -1.700 2.9e-05
fibroadenoma -1.700 8.3e-03
Breast cancer -3.100 2.9e-02
lung adenocarcinoma -2.566 6.3e-07
pancreatic carcinoma -1.700 6.8e-03
invasive ductal carcinoma -1.800 2.3e-02
nasopharyngeal carcinoma -1.100 2.1e-02
lung carcinoma -3.200 5.2e-22
spina bifida -1.090 2.2e-02
ductal carcinoma in situ -1.500 5.3e-03
ulcerative colitis -1.100 4.5e-04
ovarian cancer -4.100 3.9e-09
pituitary cancer -2.000 1.9e-04
Down syndrome 1.400 1.1e-02
chronic rhinosinusitis -1.297 3.0e-02

Protein-protein Interaction (7)

Gene RIF (240)

PMID Text
27027284 studies identify gain of MEKK3 signalling and KLF2/4 function as causal mechanisms for cerebral cavernous malformations pathogenesis that may be targeted to develop new CCM therapeutics
26676883 KLF4-regulated drug resistance might, at least partially, positively regulate high-mobility group box 1 (HMGB1), which is a significant contributor to chemoresistance in osteosarcoma cells
26654770 Several novel and known AKT phosphorylation sites are identified within OCT4, SOX2 and KLF4.
26644403 Decreased KLF4 expression mediates antileukemic effects through regulation of gene and microRNA networks, containing miR-150, CDKN1A, and MYC.
26546821 CREB enhances KLF4 up-regulatory effect on apoE promoter.
26517087 KLF4 might play Janus-faced roles in oral squamous cell carcinoma, acting both as a tumor suppressor and as an oncogene.
26471298 conclude that miR-32 promotes GC cell proliferation, migration and invasion by targeting KLF4, suggesting that the miR-32-KLF4 pathway may be useful in clinical diagnosis and therapeutics
26457418 Kruppel-Like Factor 4 Overexpression Initiates a Mesenchymal-to-Epithelial Transition and Redifferentiation of Human Pancreatic Cells following Expansion in Long Term Adherent Culture
26431332 KLF4, together with BLIMP1, plays a critical role in mediating lytic Epstein-Barr virus reactivation in epithelial cells.
26420673 Arginine methylation of KLF4 by PRMT5 inhibits KLF4 ubiquitylation by VHL and thereby reduces KLF4 turnover.
26408402 The p53-KLF4-CEBPA axis is deregulated in AML but can be functionally restored by conventional chemotherapy and novel p53 activating treatments.
26372274 Expression of KLF4 in mononuclear leukocytes positively correlates with cellular markers of immune activation, whereas KLF2 expression negatively correlates with markers of subclinical atherosclerosis in this HIV-infected population.
26338995 The dysregulated KLF4/HNF-6 pathway drives dedifferentition and progression of HCC.
26241060 these findings identify KLF4 as a nodal transcriptional regulator of mitochondrial homeostasis.
26238073 the expression of KLF4003 was epigenetically regulated by methylation status of a KLF4003 CpG island in human hepatocellular carcinoma
26227255 these are the first two cases reported of the simultaneous occurrence of secretory meningiomas with mutation of KLF4 in collision with a glioblastoma and an anaplastic astrocytoma, respectively
26214161 findings suggest that KLF4 may represent a potential biomarker for EC dysfunction
26191201 miR-10b was upregulated in gastric cancer and may have a key role in GC pathogenesis and development through the downregulation of its target gene KLF4.
26181633 our study reveals that Ang II downregulates miR-145 to regulate Klf4 and myocardin expression in HCASMCs under high glucose conditions. Ang II plays a critical role in the regulation of miR-145 under hyperglycemic conditions
26113043 KLF4 is probably repressed by histone acetylation in lung cancer.
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
26109433 Data indicte that Kruppel-like factor 4 (KLF4) regulates the autophagy receptor gene ubiquitin-binding protein p62 (SQSTM1).
26108068 Angiotensin II can modulate epigenetic regulation in podocytes and renin-angiotensin blockade inhibits these actions in part via KLF4 in proteinuric kidney diseases.
26097551 down-regulation of KLF4 and up-regulation of KLF5 may stimulate oral carcinoma progression through the dedifferentiation of carcinoma cells.
26087183 Authors demonstrate that F-box only protein 22 (FBXO22) interacts with and thereby destabilizes KLF4 via polyubiquitination. As a result, FBXO22 could promote HCC cells proliferation.
26075898 KLF4 promotes angiogenesis by transcriptionally activating vascular endothelial growth factor expression, thus activating the vascular endothelial growth factor signaling pathway in human retinal microvascular endothelial cells.
26050649 demonstrated that BAALC blocks ERK-mediated monocytic differentiation of acute myeloid leukemia cells by trapping Kruppel-like factor 4 (KLF4) in the cytoplasm and inhibiting its function in the nucleus
26046571 In the atherosclerosis mouse model they found that loss of Klf4 exclusively in SMCs resulted in a 50% reduction in atherosclerosis
25985364 Our findings indicate that the contribution of SMCs to atherosclerotic plaques has been greatly underestimated, and that KLF4-dependent transitions in SMC phenotype are critical in lesion pathogenesis
25954999 Results showed that KLF4 plays an important role in inhibiting the aggressiveness of hepatocellular carcinoma cells via upregulation of TIMP-1 and TIMP-2.
25907774 expression of OCT4, SOX2, KLF4 and MYC (OSKM) induced pluripotent stem cell differentiation
25892014 The hypermethylation of KLF4 directly mediated by Dnmt1 contributes to the progression of EMT in renal epithelial cells.
25879941 Nuclear factor I-C regulates E-cadherin via control of KLF4 in breast cancer
25860962 upregulated Siat7A expression, which was paralleled by the increased Klf4 in the ischemic myocardium, contributed to cardiomyocyte apoptosis following myocardial infarction
25851906 Decreased KLF4 was associated with Esophageal Squamous Cell Carcinoma.
25791170 induction of a miR-200c-SUMOylated KLF4 feedback loop is a significant aspect of the PDGF-BB proliferative response in VSMCs and that targeting Ubc9 represents a novel approach for the prevention of restenosis.
25789974 These results identify KLF4 and KLF5 as cooperating protumorigenic factors and critical participants in resistance to lapatinib, furthering the rationale for combining anti-MCL1/BCL-XL inhibitors with conventional HER2-targeted therapies.
25772473 KLF4 N-terminal variance modulates induced reprogramming to pluripotency
25756955 KLF4 acts as a counter-regulatory transcription factor in pneumococci-related proinflammatory activation of lung epithelial cells.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25644173 These results suggest that KLF4 as a major transcription factor that suppresses the expression of T-cell associated genes, thus inhibiting T-ALL progression.
25531393 Overexpression of KLF4 inhibited virus-induced activation of ISRE and IFN-b promoter in cells, while knockdown of KLF4 potentiated viral infection-triggered induction of IFNB1 and downstream genes and attenuated viral replication.
25400747 KLF4 might act as a tumor suppressor in esophageal squamous cell carcinoma and the expression status of KLF4 could be considered as a prognosis predictor.
25341045 HDAC1 and Klf4 are potential new molecular markers and targets for clinical diagnosis, prognosis, and treatment of myeloid leukemia.
25218589 miR-152 inhibited the cell proliferation, migration, invasion, and promoted apoptosis of glioblastoma stem cells by directly targeting KLF4.
25181544 miR-7 acts as an oncomiR in the epithelial cellular context, where through the negative regulation of KLF4-dependent signaling pathways, miR-7 promotes cellular transformation and tumor growth.
25175483 Enhanced expression of ABCG2 and KLF4 in the recurrent PCa tissues postulates the suggestion that enrichment for cells with stem cell characteristics in these tissues might be playing a critical role for chemoresistance and recurrence of cancer.
25146389 Twist1-Jagged1/KLF4 axis is essential both for transdifferentiation of tumour cells into endothelial cells and for chemoresistance acquisition.
25137052 KLF4 functions as a tumor suppressor gene in ovarian cancer cells by inhibiting TGFB-induced epithelial mesenchymal transition.
25109409 Inhibition of KLF4 by NOTCH1 regulates proliferation and differentiation of bladder cancer cells.
25100730 KLF4 is a regulator of cardiac hypertrophy by modulating the expression and the activity of myocardin.
25060774 Low KLF4 level is associated with colorectal cancer.
25037230 This study identified a novel miR-2909-KLF4 molecular axis able to differentiate between the pathogeneses of pediatric B- and T-cell ALLs, and which may represent a new diagnostic/prognostic marker.
24993134 Silencing of KLF4 expression resulted in the abolishment of LPA-stimulated migration and proliferation of PC-3M-luc-C6 cells.
24978920 p53, KLF4, and p21 showed altered expression patterns in pulmonary neuroendocrine neoplasms. Lack of KLF4 and p21 expression was associated with accumulation of aggressive features in typical carcinoids.
24947925 KLF4 underexpression is correlated with disease stage and pancreatic cancer progression.
24931170 WISP2 has a role in regulating tumor cell susceptibility through EMT by inducing the TGF-beta signaling pathway, KLF-4 expression and miR-7 inhibition.
24928509 study implicates the A2bAR as a regulator of adipocyte differentiation and the A2bAR-KLF4 axis as a potentially significant modulator of adipose biology.
24897024 High cytoplasmic expression of KLF4 was associated with better disease-specific survival and was an independently favorable prognostic factor in hepatocellular carcinoma.
24812666 KLF4 overexpression in cultured podocytes increased expression of nephrin and other epithelial markers and reduced mesenchymal gene expression.
24789055 The acetylated histone H3 located more at KLF4 promoter region.
24763828 NS suppression in the AGS cell line caused some morphological alterations, a cell cycle arrest at G1 phase, and an upregulation of iPS genes: Nanog, Sox2, and Klf4.
24755985 Hemodynamics influence endothelial KLF4 expression through DNA methyltransferase enrichment/myocyte enhancer factor-2 inhibition mechanisms of KLF4 promoter CpG methylation with regional consequences for atherosusceptibility.
24626089 Results argue that KLF5 acts as a fundamental core regulator of intestinal oncogenesis at the stem-cell level, and they suggest KLF5 targeting as a rational strategy to eradicate stem-like cells in colorectal cancer.
24573354 KLF4 and HOXD10 were identified as direct targets of miR-10b in bladder cancer cells
24551169 KLF4 gene is inactivated by methylation-induced silencing mechanisms in a large subset of cervical carcinomas.
24415058 Our data suggest that the effects of miR-34a on apoptosis occur due to the downregulation of KLF4
24388984 analysis of Klf4 ubiquitination sites using several Klf4 deletion fragments and bioinformatics predictions showed that the lysine sites which are signaling for Klf4 protein degradation lie in its N-terminal domain (aa 1-296)
24318462 our results indicated that KLF4 is a key transcriptional regulator of BTB function by regulating expressions of tight junction related proteins, which would draw growing attention to KLF4 as a potential target for glioma therapy.
24281002 Both miR-29a high expression and KLF4 mRNA low expression were associated with metastasis.
24156273 Endothelial KLF4 regulates the transcription of genes involved in key pathways implicated in pulmonary arterial hypertension.
24114958 Radiation exposure of the tissues around brain tumour during radiation therapy causes KLF4 overexpression in astrocytes, which induces more DSB and reduces SSB.
24105022 KLF4 may play an anti-oncogenic role in gastric tumorigenesis.
24067139 The present findings revealed that KLF4 is overexpressed in Burkitt pediatric lymphoma and is a potential biomarker for inferior overall survival.
24065485 loss of KLF4 expression correlates with diffuse-type gastric cancer and immunoreactivity to Fas, and are inversely linked with p53 nuclear accumulation.
24060351 ChIP analysis established that PDGF-BB-induced repression of Myocd gene expression is most likely regulated by enhanced binding of Klf4 and Klf5 to a lesser extent, to the PRR of PrmM
24030402 Human aortic aneurysms demonstrate significantly higher transgenic KLF4 expression that is localized to smooth muscle cells.
24018236 KLF4 may function as a tumor suppressor gene in urothelial cancer since down-regulation of KLF4 by promoter hypermethylation would promote cancer progression.
23926105 Co-transfection of KLF-4 and HDAC1,2 expression plasmids in breast cancer cells results in synergistic repression of VEGF expression and inhibition of angiogenic potential
23921950 Here we report that the combination of p63, a master regulator of epidermal development and differentiation, and KLF4, a regulator of epidermal differentiation, is sufficient to convert dermal fibroblasts to a keratinocyte phenotype.
23884216 downregulated expression in human monocyte in patients with coronary atherosclerosis
23867820 microRNA-15a has a key role in the KLF4 suppressions of proliferation and angiogenesis in endothelial and vascular smooth muscle cells
23861801 Attenuation of kruppel-like factor 4 facilitates carcinogenesis by inducing g1/s phase arrest in clear cell renal cell carcinoma.
23758499 Patients with nasopharyngeal carcinoma (NPC) showing lower cytoplasmic KLF4 expression had a significantly shorter overall survival time than those with high NPC KLF4 expression.
23737434 KLF4 modulates maintenance of myeloid-derived suppressor cells (MDSCs) in bone marrow by inducing GM-CSF production via CXCL5 and regulates recruitment of MDSCs into the primary tumors through the CXCL5/CXCR2 axis
23722653 KLF4 is a putative tumor suppressor gene epigenetically silenced in renal cell cancers by promoter CpG methylation and that it has prognostic value for renal cell progression.
23696417 MiR-10a restores the differentiation capability of aged hMSCs through repression of KLF4.
23599428 KLF4 is part of a multiprotein complex that interacts that the hINV promoter distal regulatory region to drive differentiation-dependent hINV gene expression in epidermis.
23585530 Kruppel-like factor 4 plays a role in controlling cell cycle and resistance to alkylating agents in multiple myeloma cells.
23515309 the importance KLF4 sumoylation in regulating pluripotency and adipocyte differentiation.
23440423 Numbl-Klf4 signaling is critical to maintain multiple nodes of metastatic progression, including persistence of cancer-initiating cells.
23418515 Data suggest that KLF4 can be a potential therapeutic target for treating colon cancer.
23404370 The findings of this study suggested an essential contribution of combined KLF4 K409Q and TRAF7 mutations in the genesis of secretory meningioma and demonstrate a role for TRAF7 alterations in other non-NF2 meningiomas.
23395444 Data show that ACTL6a prevents SWI/SNF complex binding to promoters of KLF4 and other differentiation genes and that SWI/SNF catalytic subunits are required for full induction of KLF4 targets.
23384942 Results suggest that miR-7 and KLF4 may serve as biomarkers or therapeutic targets for brain metastasis of breast cancer.
23376074 these results suggest that E-cadherin expression in cancer cells is controlled by a balance between ZEB2 and KLF4 expression levels.
23348505 Meningioma mutations in TRAF7 commonly occurred with a recurrent mutation (K409Q) in KLF4, a transcription factor known for its role in inducing pluripotency, or with AKT1, a mutation known to activate the PI3K pathway.
23275339 up-regulation of KLF4 upon PPARgamma activation is mediated through the PPRE in the KLF4 promoter
23249717 Data indicat that the SPARC overexpression may play an important role in the initiation and development of non-small cell lung cancer (NSCLC), whereas KLF4 inhibits this process.
23202735 CDX2-driven leukemogenesis involves KLF4 repression and deregulated PPARgamma signaling.
23160196 KLF4 differentially regulated pertinent endothelial targets via competition for the coactivator p300.
23118962 the cooperative binding of KLF4 and p53 to DNA exemplifies a regulatory mechanism that contributes to p53 target selectivity
23097599 LMP3 induced the successful osteogenic differentiation of AFSC by inducing the expression of osteogenic markers and osteospecific transcription factors.
23089465 High Klf4 expression in the cytoplasm is associated with prostate cancer.
23045286 KLF4 contributes to the favorable disease outcome by directly mediating the growth and lineage determination of neuroblastoma cells.
23007394 the HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss
22937066 Kruppel-like factor 4, a tumor suppressor in hepatocellular carcinoma cells reverts epithelial mesenchymal transition by suppressing slug expression.
22854048 We conclude that KLF4 upregulation by HGF represents a novel mechanism mediating HGF-induced cell scattering and perhaps other associated events such as cell migration and invasion
22842522 Our findings establish the impact of Oct1, KLF4 and c-Myc on cancer bioenergetics and evidence a link between oncosecretomics and cellular bioenergetics profile.
22835519 LIF combined with VEGF can maintain the preliminary, progenitor phenotype of EPCs and alleviate cell differentiation by upregulating KLF4, which may provide new insights into transcriptional regulation in endothelial progenitor cells
22766303 Both Sox9 and KLF4 interact with beta-catenin in an immunoprecipitation assay and reduce its binding to TCF4.
22677193 KLF4 binds to the promoter of VDR to regulate its expression altering signal transduction and contributing to the progression of hepatocellular carcinoma.
22653776 KLF4 is induced in a bacterial DNA-TLR9-Src-dependent manner and regulates IL-10 expression
22592916 KLF4 translation level is associated with the differentiation stage of different leukemias and is independent of other parameters of risk stratification.
22539002 Data suggest that there is a partial functional redundancy between Sox2 and Klf4 in the disruption of cellular homeostasis and activation of regulatory networks that define pluripotency.
22528804 KLF4 has a suppressive effect on the proliferation and metastasis of the breast cancer.
22491752 data suggest that KLF4 inhibits cell proliferation, migration and adhesion and that loss of KLF4 promotes skin tumorigenesis
22430140 The present study demonstrated a key regulatory role of KLF4 in the endothelial ASS1 expression and NO production in response to laminar shear stress.
22407433 KLF4 inhibits beta-catenin expression and regulates the beta-catenin-mediated biological behaviors of gastric cancer cells.
22389506 suppression of pVHL in response to estrogen signaling results in elevation of KLF4, which mediates estrogen-induced mitogenic effect
22384261 KLF4 affects intestinal epithelial cell morphology by regulating proliferation, differentiation and polarity of the cells
22364861 ZNF750 directly links a tissue-specifying factor, p63, to an effector of terminal differentiation, KLF4.
22282354 TGF-beta1 downregulates AT1 receptor expression via PKC-delta-mediated Sp1 dissociation from KLF4 and Smad-mediated PPAR-gamma association with KLF4.
22267480 miR-92a coregulates KLF4 and KLF2 expression in arterial endothelium and contributes to phenotype heterogeneity associated with regional atherosusceptibility and protection in vivo.
22209344 Patients with oral cancer with negative nuclear Kruppel-like factor 4 expression in tumor cells had poor prognoses and a 2.5-fold higher death risk.
22170594 KLF4 may function as a tumor suppressor in cervical carcinoma by inhibiting cell growth and tumor formation.
22170051 Regulation of the potential marker for intestinal cells, Bmi1, by beta-catenin and the zinc finger protein KLF4: implications for colon cancer.
21833590 Data sugget that KLF4 regulates the cellular sensitivity to cisplatin in hepatocarcinoma stem-like cells and hepatocarcinoma cells by elevating intracellular glutathione levels.
21746878 Klf4 recruits a complex of Meis and Pbx proteins to DNA, resulting in Meis2 transcriptional activation domain-dependent activation of a subset of Klf4 target genes.
21689550 Findings suggest that KLF4 is able to promote odontoblastic differentiation of and inhibit proliferation of human dental pulp cells.
21674249 Loss of nuclear expression of KLF4 is associated with in situ and invasive breast carcinomas.
21673106 down-regulation of Kruppel-like factor-4 (KLF4) by microRNA-143/145 is critical for modulation of vascular smooth muscle cell phenotype by transforming growth factor-beta and bone morphogenetic protein 4.
21670502 These data suggest that KLF4 is a novel regulator of macrophage polarization.
21652709 KLF4-siRNA inhibits PKCdelta-dependent p21(Cip1) promoter activity. PKCdelta increases KLF4 expression leading to enhanced KLF4 interaction with the GC-rich elements in the p21(Cip1) promoter to activate transcription
21586797 KLF4 plays a role in maintenance of high glycolytic metabolism by transcriptional activation of the PFKP gene in breast cancer cells.
21539536 Our data supports a model of antagonistic interaction of KLF4/CREBBP trans-factors in HBG regulation.
21531817 Restored expression of KLF4, a putative tumor suppressor, downregulated IFITM3 expression in colon cancer cells in vitro.
21518959 Results identify a KLF4-miR-206 feedback pathway that oppositely affects protein translation in normal cells and cancer cells.
21502426 KLF4 is another marker of monocytic differentiation in monocytic leukemias
21412023 These results suggest a relationship between D9S105 deletion and downregulation of KLF4 gene expression as an early event in pancreatic ductal adenocarcinoma progression.
21312053 results suggest that PAF receptor plays a pivotal role in POVPC-induced migration of human BMSCs through PAF receptor-mediated expression of KLF4
21242971 study provides evidence that KLF4 has a potent oncogenic role in mammary tumorigenesis likely by maintaining stem cell-like features and by promoting cell migration and invasion
21224073 Loss of KLF4 expression is closely related to the genomic loss, and its restoration inhibits cancer cell proliferation, suggesting a key suppressor role in pancreatic tumorigenesis.
21219537 Low KLF4 is associated with head and neck squamous cell carcinoma.
21177849 KLF4 is profoundly degraded in response to TGF-beta signaling
21166929 MEK5 activation by laminar shear stress inhibits inflammatory responses in microvascular endothelial cells, in part through ERK5-dependent induction of KLF4
21159640 Results suggest that KLF4 functions as an inhibitor of tumor cell growth and migration in prostate cancer and decreased expression has prognostic value for predicting prostate cancer metastasis.
21132436 reduced expression in skin cancer lesions
21125297 Longitudinal cell formation in the small intestine was regulated by the colocalization of Hath1 and Klf4 that converted Paneth cell differentiation into goblet cell differentiation.
21075859 Dopamine acting through its D(2) receptor, inhibits IGF-I-induced proliferation of gastric adenocarcinoma cells by up-regulating KLF4, a negative regulator of the cell cycle through down regulation of IGF-IR and AKT phosphorylation.
20972454 tumor-predisposing p53 mutations hijack p63 to a different location on the promoter, turning it into an activator of KLF4.
20849362 These results provide new insights toward understanding the molecular basis of mesenchymal stromal cells stemness maintenance and underline the ability of KLF4 to maintain cells in an undifferentiated state.
20727893 a splice variant of KLF4 (KLF4alpha) is up-regulated in aggressive pancreatic cancer cells and human pancreatic tumor tissues
20718868 Data indicate up-regulation of KLF4 expression(by high-density lipoproteins, especially HDL3) causes up-regulation of expression of SR-BI (scavenger receptor class B type I); KLF4 binds to promoter for SR-BI.
20699379 KLF4 expression is significantly downregulated in colon cancer, and loss of KLF4 is an independent predictor of survival and recurrence
20629177 hTERT is one of the major targets of KLF4 in cancer and stem cells to maintain long-term proliferation potential.
20551324 KLF4 expression largely reproduces the protective phenotype in endothelial cellsdecreased angiogenic, migratory, and inflammatory potential
20519630 Loss of KLF4 is associated with B-cell non-Hodgkin lymphoma and in classic Hodgkin lymphoma.
20479568 In terms of human reproductive tissue, KLF4 may be a factor concerning cell cycle, directly responsive to progesterone receptor activation.
20442780 the two factors Klf4 and Sp3 exert an overlapping repressor function through their binding to the Notch1 promoter.
20385121 KLF4 is identified as a novel transcription factor that controls NAG-1 promoter activity in human and mouse colorectal cancers. And PPARgamma agonists up-regulate KLF4 expression in receptor-dependent manner.
20356845 Kruppel-like factor 4 inhibits epithelial-to-mesenchymal transition through regulation of E-cadherin gene expression
20215880 Reduced KLF4 is associated with lung cancer cell invasion by suppression of SPARC expression
20075075 overexpression of miR-10b in KYSE140 and KYSE450 cells led to a reduction of endogenous KLF4 protein, whereas silencing of miR-10b in EC9706 cells caused up-regulation of KLF4 protein in esophageal cancer
20072650 Data show that that KLF4 is inactivated by either genetic or epigenetic mechanisms in a large subset of medulloblastomas and that it likely functions as a tumor suppressor gene in the pathogenesis of medulloblastoma.
20071344 Klf4 functions upstream of Nanog in ES cell self-renewal and in preventing ES cell differentiation
20043075 down-regulated KLF4, CHGA, GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer
20030945 Expression of KLF-4 increases under IL-1beta and TNF-alpha stimulation, and may participate in regulation of endothelial activity.
19968965 these data identify a significant degree of mechanistic and functional conservation between KLF2 and KLF4, and importantly, provide further insights into the complex regulatory networks governing endothelial vasoprotection.
19858207 Kruppel-like factor 4 is a novel mediator of Kallistatin in inhibiting endothelial inflammation via increased endothelial nitric-oxide synthase expression.
19816951 show that Klf4 interacts directly with Oct4 and Sox2 when expressed at levels sufficient to induce induced pluripotent stem cells.
19779097 KLF4 is potentially a reliable marker of HNSCC, and myrAkt transgenic mice are valuable tools for preclinical research of HNSCC.
19763260 human neural stem cells are capable of reprogramming into a pluripotent state by forced expression of Oct3/4 and Klf4
19737957 The expression of KLF4 resulted in marked inhibition of cell growth and clonogenic formation. The tumor-suppressive effect was associated with in up-regulating p21 and down-regulating cyclin D1, leading to cell cycle arrest at the G(1)-S checkpoint.
19717984 Results suggest that KLF4 could contribute to breast tumor progression by activating synthesis of Notch1 and by promoting signaling through a non-canonical Notch1 pathway.
19696409 Induced pluripotent stem cells programmed with OCT4/SOX2/KLF4 and without c-MYC yield proficient cardiogenesis for functional heart chimerism.
19549847 Stoichiometric and temporal requirements of Oct4, Sox2, Klf4, and c-Myc expression for efficient human iPSC induction and differentiation.
19544095 KLF4 binds to the p57(Kip2) promoter and transcriptionally upregulates its expression, which in turn inhibits the stress activated protein kinase cascade and c-Jun phosphorylation.
19541842 inhibition of miR-25 in cytokine-stimulated ASM cells up-regulates KLF4 expression via a post-transcriptional mechanism.
19522013 Data showed that both KLF4 and PBX1 mRNA and protein expression were downregulated during hESC differentiation. Overexpression of KLF4 and PBX1 upregulated NANOG promoter activity and NANOG protein expression.
19505997 The finding suggests that KLF4 may be an important factor for the maintenance of the developmental and the tumorigenic potential of IGCNU as well as for the malignancy of seminoma.
19503094 Studies discovered a novel molecular network between p53, KLF4 and ERalpha.
19495417 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b
19458492 Studies show that the expression of genes belonging to the OCT3/SOX2/NANOG/KLF4 core circuitry that acts at the highest level in regulating stem cell biology.
19409607 Increased miR-145 expression inhibits human embryonic stem cells self-renewal, represses expression of pluripotency genes, and induces lineage-restricted differentiation; loss of miR-145 impairs differentiation and elevates OCT4, SOX2, and KLF4.
19361279 Luciferase reporter gene assays revealed that survivin promoter activity is repressed upon overexpression of KLF4 in EC9706 cells.
19327128 Results indicate that KLF4 positively regulates human ghrelin expression via binding to a KLF-responsive region in the promoter.
19197145 KLF4 pathway is a potential effector of retinoid signaling in tumor prevention. Of several oncogenes that independently induce malignant transformation of RK3E epithelial cells, only KLF4 showed substantial sensitivity to retinoids.
19074836 Notch signaling suppresses KLF4 expression in intestinal tumors and colorectal cancer cells
18977346 Reduced levels of KLF4 tumor suppressor activity in colon tumors may be driven by elevated beta-catenin/Tcf signaling.
18390749 The inflammation-selective effects of loss-of-KLF4 and the gain-of-KLF4-induced monocytic differentiation in HL60 cells identify KLF4 as a key regulator of monocytic differentiation
18376139 KLF4 expression is associated with human skin SCC progression and metastases
18264726 Loss of KLF4 protein expression might contribute to assessing prognosis in colorectal cancer with lymph node metastasis
18157115 Using ectopic expression of Oct4, Sox2, Klf4 and Myc, we have derived iPS cells from fetal, neonatal and adult human primary cells
18056793 Transient transfection of Kruppel-like factor 4 suppressed LDLR, steroidogenic acute regulatory protein, and CYP11A
17932114 Data show that human testis strongly expresses KLF4 and they were localized to nuclei of round spermatids during normal spermatogenesis stages II-IV.
17908689 KLF4 might function as an activator or repressor of transcription depending on whether it interacts with co-activators such as p300 and CREB-binding protein or co-repressors such as HDAC3.
17762869 KLF4 is a critical regulator in the transcriptional network controlling monocyte differentiation.
17688680 Observational study of gene-disease association. (HuGE Navigator)
17688680 analysis of SNPs, located in the KLF2, KLF4 and KLF5 gene did not show an association with Type 2 diabetes in this French population
17671182 This study reports that haploinsufficiency of Klf4 gene in transgenic mice with targeted deletion of one of the Klf4 alleles promotes intestinal tumorigenesis when crossbred with the ApcMin mice.
17614846 Genetic and epigenetic alterations of the KLF4 gene might play a minor role in gastric carcinogenesis.
17508399 A review article that summarizes the biological and pathobiological functions in the intestinal epithelium.
17339326 Kruppel-like factor 4 as a novel regulator of endothelial activation in response to pro-inflammatory stimuli.
17135299 KLF-4 and AP-2 is regulating the activity of the hSMVT promoter in the intestine and provide direct in vivo confirmation of hSMVT promoter activity.
17017123 KLF4 exerts a global inhibitory effect on macromolecular biosynthesis that is beyond its established role as a cell cycle inhibitor.
17016435 KLF4 may be an important determinant of cell fate following gamma-radiation-induced DNA damage.
16632465 cGMP-dependent protein kinase expression is regulated by Rho and Kruppel-like transcription factor-4
16507986 the cross talk of KLF4 and beta-catenin plays a critical role in homeostasis of the normal intestine as well as in tumorigenesis of colorectal cancers.
15937668 Observational study of gene-disease association. (HuGE Navigator)
15806166 KLF4 is both necessary and sufficient in preventing centrosome amplification following gamma-radiation-induced DNA damage.
15805274 Promoter hypermethylation and hemizygous deletion contributed to the down-regulation of KLF4 expression and the induction of apoptosis contributed to the antitumor activity of KLF4; alteration of KLF4 expression plays a role in gastric cancer development.
15740636 A review article that summarizes the mechanisms by which KLF4 and KLF5 regulate cell proliferation.
15674344 KLF4 can function in the nucleus to induce squamous epithelial dysplasia.
15561714 a longer isoform of gut-enriched Kruppel-like factor 4 (GKLF) we term GKLFa interacts with the CD11d promoter
15102675 KLF4 has a role in the aggressive phenotype of early-stage infiltrating ductal carcinoma
15051827 transactivation of Kruppel-like factor 4(KLF4) by butyrate appears to be mediated through interaction with a Sp1 transcription factor-binding domain on the promoter
15031282 KLF4 is a novel regulator of u-PAR expression that drives the synthesis of u-PAR in the luminal surface epithelial cells of the colon
14724568 KLF4 is a tumor suppressor in colorectal cancer.
14670968 KLF4 can act to repress histidine decarboxylase gene expression by Sp1-dependent and -independent mechanisms
14627709 role of KLF4 in maintaining the integrity of the G2/M checkpoint following DNA damage
14627709 KLF4 is necessary for preventing the entry into mitosis following DNA damage
12919939 intestinal alkaline transactivation by Kruppel-like factor-4 is likely mediated through a critical region located within the proximal IAP promoter region
12901861 inactivation of KLF4 is one of the frequent steps towards bladder carcinogenesis
12853980 Regulation of A33 antigen expression by GKLF.
12776194 Over-expression of KLF4 in human colon cancer cells reduces tumorigenecity.
12581631 role in cell cycle regulation and epithelial differentiation
12439907 down-regulation of gut-enriched Kruppel-like factor in esophageal squamous cancer
12427745 KLF4 is an essential mediator of p53 in controlling G(1)/S progression of the cell cycle following DNA damage
12297499 induction of GKLF mRNA and protein expression by interferon-gamma treatment was associated with reduction of ornithine decarboxylase (ODC) gene expression and enzyme activity in colon cancer HT-29 cells
12087155 This paper describes the opposite effect of KLF4 and KLF5 on transcription of the KLF4 gene.
11521200 This paper reports that KLF4 is regulated by the APC tumor suppressor in colorectal cancer cells through CDX2.
10749849 This paper describes that KLF4 is transcriptionally activated by the p53 tumor suppressor after DNA damage and results in the transcriptional activation of the p21 cell cycle inhibitor gene.
10666450 This paper examines the structure-function relationship of KLF4 in activating target gene expression and in suppressing growth.
10556311 This study characterized the gene and promoter structures of the mouse KLF4 gene.
9651398 This study reports the first identified target gene for KLF4 was CYP1A1, and the mechanism by which KLF4 regulates CYP1A1 expression.
9443972 This paper reports a consensus DNA binding sequence for KLF4 using an unbiased screen.
9428642 This study examines the expression of KLF4 during embryonic and postnatal development and in intestinal tumorigenesis.
9218496 This paper describes that the nuclear localization signals within KLF4 define a closely related subfamily of Kruppel-like factors including KLF1, KLF2 and KLF4.
8702718 This is the first paper that describes the identification and characterization of KLF4 (also called GKLF) and that KLF4 is inhibitor of cell growth.

AA Sequence

MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATV      1 - 70
ATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSG     71 - 140
PASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDP    141 - 210
VYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQE    211 - 280
AVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS    281 - 350
FLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR    351 - 420
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPF    421 - 490
QCQKCDRAFSRSDHLALHMKRHF                                                   491 - 513
//

Text Mined References (263)

PMID Year Title
27027284 2016 Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling.
26676883 2016 Krüppel-like factor 4 promotes high-mobility group box 1-induced chemotherapy resistance in osteosarcoma cells.
26654770 2015 Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4.
26644403 2015 Deregulated KLF4 Expression in Myeloid Leukemias Alters Cell Proliferation and Differentiation through MicroRNA and Gene Targets.
26546821 2015 Krüppel-like factor 4 synergizes with CREB to increase the activity of apolipoprotein E gene promoter in macrophages.
26517087 2015 The Janus-faced roles of Krüppel-like factor 4 in oral squamous cell carcinoma cells.
26471298 2015 MiR-32 promotes gastric carcinoma tumorigenesis by targeting Kruppel-like factor 4.
26457418 2015 Krüppel-Like Factor 4 Overexpression Initiates a Mesenchymal-to-Epithelial Transition and Redifferentiation of Human Pancreatic Cells following Expansion in Long Term Adherent Culture.
26431332 2015 Differentiation-Dependent KLF4 Expression Promotes Lytic Epstein-Barr Virus Infection in Epithelial Cells.
26420673 2015 Interplay between arginine methylation and ubiquitylation regulates KLF4-mediated genome stability and carcinogenesis.
26408402 2016 Inactivation of the p53-KLF4-CEBPA Axis in Acute Myeloid Leukemia.
26372274 2015 HIV vasculopathy: role of mononuclear cell-associated Krüppel-like factors 2 and 4.
26338995 2016 Krüppel-like Factor 4 Blocks Hepatocellular Carcinoma Dedifferentiation and Progression through Activation of Hepatocyte Nuclear Factor-6.
26241060 2015 Kruppel-like factor 4 is critical for transcriptional control of cardiac mitochondrial homeostasis.
26238073 2015 Identification of a non-coding KLF4 transcript generated from intron retention and downregulated in human hepatocellular carcinoma.
26227255 Secretory meningioma with KLF4 K409Q mutation in collision with glioma.
26214161 2015 Circulating Endothelial Cells Expressing the Angiogenic Transcription Factor Krüppel-Like Factor 4 are Decreased in Patients with Coronary Artery Disease.
26191201 2015 Augmented miR-10b expression associated with depressed expression of its target gene KLF4 involved in gastric carcinoma.
26181633 2015 Angiotensin II Downregulates MicroRNA-145 to Regulate Kruppel-like Factor 4 and Myocardin Expression in Human Coronary Arterial Smooth Muscle Cells under High Glucose Conditions.
26113043 2016 KLF4 regulates adult lung tumor-initiating cells and represses K-Ras-mediated lung cancer.
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
26109433 2015 KLF4-SQSTM1/p62-associated prosurvival autophagy contributes to carfilzomib resistance in multiple myeloma models.
26108068 2015 Renin-angiotensin blockade resets podocyte epigenome through Kruppel-like Factor 4 and attenuates proteinuria.
26097551 2015 Krüppel-like factors 4 and 5 expression and their involvement in differentiation of oral carcinomas.
26087183 2015 F-box protein FBXO22 mediates polyubiquitination and degradation of KLF4 to promote hepatocellular carcinoma progression.
26075898 2015 KLF4 Promotes Angiogenesis by Activating VEGF Signaling in Human Retinal Microvascular Endothelial Cells.
26050649 2015 BAALC potentiates oncogenic ERK pathway through interactions with MEKK1 and KLF4.
26046571 2015 Converting smooth muscle cells to macrophage-like cells with KLF4 in atherosclerotic plaques.
25985364 2015 KLF4-dependent phenotypic modulation of smooth muscle cells has a key role in atherosclerotic plaque pathogenesis.
25954999 2015 Krüppel-like factor 4 modulates the migration and invasion of hepatoma cells by suppressing TIMP-1 and TIMP-2.
25907774 2015 Gene expression of OCT4, SOX2, KLF4 and MYC (OSKM) induced pluripotent stem cells: identification for potential mechanisms.
25892014 2015 Epigenetic repression of Krüppel-like factor 4 through Dnmt1 contributes to EMT in renal fibrosis.
25879941 2015 Nuclear factor I-C regulates E-cadherin via control of KLF4 in breast cancer.
25860962 2015 Sialyltransferase7A, a Klf4-responsive gene, promotes cardiomyocyte apoptosis during myocardial infarction.
25851906 2015 Krüppel-like Factor 4 Promotes Esophageal Squamous Cell Carcinoma Differentiation by Up-regulating Keratin 13 Expression.
25791170 2015 miR-200c-SUMOylated KLF4 feedback loop acts as a switch in transcriptional programs that control VSMC proliferation.
25789974 2015 Regulation of anti-apoptotic signaling by Kruppel-like factors 4 and 5 mediates lapatinib resistance in breast cancer.
25772473 2015 KLF4 N-terminal variance modulates induced reprogramming to pluripotency.
25756955 2015 Role of Pneumococcal Autolysin for KLF4 Expression and Chemokine Secretion in Lung Epithelium.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25644173 2015 Genome-wide analyses identify KLF4 as an important negative regulator in T-cell acute lymphoblastic leukemia through directly inhibiting T-cell associated genes.
25531393 2016 Krüppel-like factor 4 negatively regulates cellular antiviral immune response.
25400747 2014 Association of Kruppel-like factor 4 expression with the prognosis of esophageal squamous cell carcinoma patients.
25341045 2014 HDAC1 and Klf4 interplay critically regulates human myeloid leukemia cell proliferation.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
25218589 2014 MiR-152 functions as a tumor suppressor in glioblastoma stem cells by targeting Krüppel-like factor 4.
25181544 2014 MiR-7 promotes epithelial cell transformation by targeting the tumor suppressor KLF4.
25175483 2014 Differential expression of stem cell markers and ABCG2 in recurrent prostate cancer.
25146389 2014 Twist1 induces endothelial differentiation of tumour cells through the Jagged1-KLF4 axis.
25137052 2014 Doxycycline inducible Krüppel-like factor 4 lentiviral vector mediates mesenchymal to epithelial transition in ovarian cancer cells.
25109409 2014 Notch-1 regulates proliferation and differentiation of human bladder cancer cell lines by inhibiting expression of Krüppel-like factor 4.
25100730 2014 Kruppel-like factor 4 protein regulates isoproterenol-induced cardiac hypertrophy by modulating myocardin expression and activity.
25060774 2014 High KLF4 level in normal tissue predicts poor survival in colorectal cancer patients.
25037230 2014 miR-2909-mediated regulation of KLF4: a novel molecular mechanism for differentiating between B-cell and T-cell pediatric acute lymphoblastic leukemias.
24993134 2014 Krüppel-like factor 4 mediates lysophosphatidic acid-stimulated migration and proliferation of PC3M prostate cancer cells.
24978920 2014 Alterations in the expression of p53, KLF4, and p21 in neuroendocrine lung tumors.
24947925 2014 A novel KLF4/LDHA signaling pathway regulates aerobic glycolysis in and progression of pancreatic cancer.
24931170 2015 Targeting WNT1-inducible signaling pathway protein 2 alters human breast cancer cell susceptibility to specific lysis through regulation of KLF-4 and miR-7 expression.
24928509 2014 An adenosine receptor-Krüppel-like factor 4 protein axis inhibits adipogenesis.
24897024 2014 High cytoplasmic expression of Krüppel-like factor 4 is an independent prognostic factor of better survival in hepatocellular carcinoma.
24812666 2014 KLF4-dependent epigenetic remodeling modulates podocyte phenotypes and attenuates proteinuria.
24789055 2015 Upregulation of KLF4 by methylseleninic acid in human esophageal squamous cell carcinoma cells: Modification of histone H3 acetylation through HAT/HDAC interplay.
24763828 2014 Concomitant upregulation of nucleostemin and downregulation of Sox2 and Klf4 in gastric adenocarcinoma.
24755985 2014 Hemodynamic disturbed flow induces differential DNA methylation of endothelial Kruppel-Like Factor 4 promoter in vitro and in vivo.
24626089 2014 KLF5 regulates the integrity and oncogenicity of intestinal stem cells.
24573354 2014 MicroRNA-10b promotes migration and invasion through KLF4 and HOXD10 in human bladder cancer.
24551169 2014 Promoter hypermethylation of KLF4 inactivates its tumor suppressor function in cervical carcinogenesis.
24415058 2014 MiR-34a regulates apoptosis in liver cells by targeting the KLF4 gene.
24388984 2014 Critical lysine residues of Klf4 required for protein stabilization and degradation.
24318462 2014 Krüppel-like factor 4 regulates blood-tumor barrier permeability via ZO-1, occludin and claudin-5.
24281002 2014 MicroRNA-29a promotes colorectal cancer metastasis by regulating matrix metalloproteinase 2 and E-cadherin via KLF4.
24156273 2014 Endothelial Krüppel-like factor 4 modulates pulmonary arterial hypertension.
24114958 2014 Contrasting effects of Krüppel-like factor 4 on X-ray-induced double-strand and single-strand DNA breaks in mouse astrocytes.
24105022 2013 Decreased Kruppel-like factor 4 (KLF4) expression may correlate with poor survival in gastric adenocarcinoma.
24067139 2014 Expression of KLF4 is a predictive marker for survival in pediatric Burkitt lymphoma.
24065485 KLF4 expression and apoptosis-related markers in gastric cancer.
24060351 2013 Identification of a Klf4-dependent upstream repressor region mediating transcriptional regulation of the myocardin gene in human smooth muscle cells.
24030402 2013 KLF4 regulates abdominal aortic aneurysm morphology and deletion attenuates aneurysm formation.
24018236 2014 Epigenetic inactivation of KLF4 is associated with urothelial cancer progression and early recurrence.
23926105 2013 Loss of epigenetic Kruppel-like factor 4 histone deacetylase (KLF-4-HDAC)-mediated transcriptional suppression is crucial in increasing vascular endothelial growth factor (VEGF) expression in breast cancer.
23921950 2014 Highly rapid and efficient conversion of human fibroblasts to keratinocyte-like cells.
23884216 2013 Atheroprotective Krüppel-like factor 4 is downregulated in monocyte subsets of patients with coronary artery disease.
23867820 2013 Key role of microRNA-15a in the KLF4 suppressions of proliferation and angiogenesis in endothelial and vascular smooth muscle cells.
23861801 2013 Attenuation of krüppel-like factor 4 facilitates carcinogenesis by inducing g1/s phase arrest in clear cell renal cell carcinoma.
23758499 2013 Loss of cytoplasmic KLF4 expression is correlated with the progression and poor prognosis of nasopharyngeal carcinoma.
23737434 2013 Deficiency of Kruppel-like factor KLF4 in mammary tumor cells inhibits tumor growth and pulmonary metastasis and is accompanied by compromised recruitment of myeloid-derived suppressor cells.
23722653 2013 Epigenetic alterations of Krüppel-like factor 4 and its tumor suppressor function in renal cell carcinoma.
23696417 2013 miR-10a restores human mesenchymal stem cell differentiation by repressing KLF4.
23599428 2013 Protein kinase C ? increases Kruppel-like factor 4 protein, which drives involucrin gene transcription in differentiating keratinocytes.
23585530 2013 Krüppel-like factor 4 blocks tumor cell proliferation and promotes drug resistance in multiple myeloma.
23515309 2013 Sumoylation of Krüppel-like factor 4 inhibits pluripotency induction but promotes adipocyte differentiation.
23440423 2013 Regulation of lung cancer metastasis by Klf4-Numb-like signaling.
23418515 2013 Krüppel-like factor 4 acts as an oncogene in colon cancer stem cell-enriched spheroid cells.
23404370 2013 Secretory meningiomas are defined by combined KLF4 K409Q and TRAF7 mutations.
23395444 2013 ACTL6a enforces the epidermal progenitor state by suppressing SWI/SNF-dependent induction of KLF4.
23384942 2013 miR-7 suppresses brain metastasis of breast cancer stem-like cells by modulating KLF4.
23376074 2013 Interplay between KLF4 and ZEB2/SIP1 in the regulation of E-cadherin expression.
23348505 2013 Genomic analysis of non-NF2 meningiomas reveals mutations in TRAF7, KLF4, AKT1, and SMO.
23275339 2013 Peroxisome proliferator-activated receptor ? agonists induce cell cycle arrest through transcriptional regulation of Kruppel-like factor 4 (KLF4).
23249717 2012 [Correlation of KLF4 and SPARC expression with the clinical characteristics of non-small cell lung cancer].
23202735 2013 CDX2-driven leukemogenesis involves KLF4 repression and deregulated PPAR? signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160196 2012 Endothelial Kruppel-like factor 4 protects against atherothrombosis in mice.
23134681 2013 Shaking the family tree: identification of novel and biologically active alternatively spliced isoforms across the KLF family of transcription factors.
23118962 2012 Molecular basis for modulation of the p53 target selectivity by KLF4.
23097599 2012 Lim mineralization protein 3 induces the osteogenic differentiation of human amniotic fluid stromal cells through Kruppel-like factor-4 downregulation and further bone-specific gene expression.
23089465 2013 Klf4 transcription factor is expressed in the cytoplasm of prostate cancer cells.
23045286 2013 Krüppel-like factor 4 (KLF4) suppresses neuroblastoma cell growth and determines non-tumorigenic lineage differentiation.
23023329 2012 Genome-wide association study in Chinese men identifies two new prostate cancer risk loci at 9q31.2 and 19q13.4.
23007394 2012 A HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss.
22937066 2012 Krüppel-like factor 4, a tumor suppressor in hepatocellular carcinoma cells reverts epithelial mesenchymal transition by suppressing slug expression.
22854048 2012 Krüppel-like factor 4 is involved in cell scattering induced by hepatocyte growth factor.
22842522 2012 Oncosecretomics coupled to bioenergetics identifies ?-amino adipic acid, isoleucine and GABA as potential biomarkers of cancer: Differential expression of c-Myc, Oct1 and KLF4 coordinates metabolic changes.
22835519 2012 LIF maintains progenitor phenotype of endothelial progenitor cells via Krüppel-like factor 4.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22766303 2012 KLF4 and SOX9 transcription factors antagonize ?-catenin and inhibit TCF-activity in cancer cells.
22723415 2012 Wnt/?-catenin signaling regulates telomerase in stem cells and cancer cells.
22677193 2012 Dysregulated Krüppel-like factor 4 and vitamin D receptor signaling contribute to progression of hepatocellular carcinoma.
22653776 2013 TLR9- and Src-dependent expression of Krueppel-like factor 4 controls interleukin-10 expression in pneumonia.
22592916 2013 KLF4 translation level is associated with differentiation stage of different pediatric leukemias in both cell lines and primary samples.
22539002 2012 Two-factor reprogramming of somatic cells to pluripotent stem cells reveals partial functional redundancy of Sox2 and Klf4.
22528804 2014 Prognostic significance of NANOG and KLF4 for breast cancer.
22491752 2012 Deficiency of the Kruppel-like factor KLF4 correlates with increased cell proliferation and enhanced skin tumorigenesis.
22430140 2012 A regulatory role of Kruppel-like factor 4 in endothelial argininosuccinate synthetase 1 expression in response to laminar shear stress.
22407433 2012 Krüppel-like factor 4 negatively regulates ?-catenin expression and inhibits the proliferation, invasion and metastasis of gastric cancer.
22389506 2012 Novel insight into KLF4 proteolytic regulation in estrogen receptor signaling and breast carcinogenesis.
22384261 2012 Krüppel-like factor 4 regulates intestinal epithelial cell morphology and polarity.
22364861 2012 ZNF750 is a p63 target gene that induces KLF4 to drive terminal epidermal differentiation.
22282354 2012 TGF-?1 downregulates AT1 receptor expression via PKC-?-mediated Sp1 dissociation from KLF4 and Smad-mediated PPAR-? association with KLF4.
22267480 2012 Site-specific microRNA-92a regulation of Kruppel-like factors 4 and 2 in atherosusceptible endothelium.
22209344 2012 Loss of nuclear expression of Krüppel-like factor 4 is associated with poor prognosis in patients with oral cancer.
22170594 2012 Krüppel-like factor 4 functions as a tumor suppressor in cervical carcinoma.
22170051 2012 Regulation of the potential marker for intestinal cells, Bmi1, by ?-catenin and the zinc finger protein KLF4: implications for colon cancer.
21833590 2012 Inhibition of glutathione synthesis reverses Krüppel-like factor 4-mediated cisplatin resistance.
21746878 2011 Cooperative transcriptional activation by Klf4, Meis2, and Pbx1.
21689550 2011 KLF4 promotes the odontoblastic differentiation of human dental pulp cells.
21674249 2012 Association of expression of kruppel-like factor 4 and kruppel-like factor 5 with the clinical manifestations of breast cancer.
21673106 2011 down-regulation of Kruppel-like factor-4 (KLF4) by microRNA-143/145 is critical for modulation of vascular smooth muscle cell phenotype by transforming growth factor-beta and bone morphogenetic protein 4.
21670502 2011 Krüppel-like factor 4 regulates macrophage polarization.
21652709 2011 Protein kinase C (PKC) delta suppresses keratinocyte proliferation by increasing p21(Cip1) level by a KLF4 transcription factor-dependent mechanism.
21586797 2011 Krüppel-like factor 4 (KLF4) activates the transcription of the gene for the platelet isoform of phosphofructokinase (PFKP) in breast cancer.
21539536 2011 Krüppel-like Factor 4 activates HBG gene expression in primary erythroid cells.
21531817 2011 KLF4-mediated negative regulation of IFITM3 expression plays a critical role in colon cancer pathogenesis.
21518959 2011 A KLF4-miRNA-206 autoregulatory feedback loop can promote or inhibit protein translation depending upon cell context.
21502426 2011 Immunohistochemical analysis of monocytic leukemias: usefulness of CD14 and Kruppel-like factor 4, a novel monocyte marker.
21412023 2011 Loss of heterozygosity status of D9S105 marker is associated with downregulation of Krüppel-like factor 4 expression in pancreatic ductal adenocarcinoma and pancreatic intraepithelial lesions.
21312053 2011 Oxidized phosphatidylcholine induces migration of bone marrow-derived mesenchymal stem cells through Krüppel-like factor 4-dependent mechanism.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
21242971 2011 Kruppel-like factor 4 (KLF4) is required for maintenance of breast cancer stem cells and for cell migration and invasion.
21224073 2011 KLF4 is a novel candidate tumor suppressor gene in pancreatic ductal carcinoma.
21219537 2011 Persistent Krüppel-like factor 4 expression predicts progression and poor prognosis of head and neck squamous cell carcinoma.
21177849 2011 Regulation of Krüppel-like factor 4 by the anaphase promoting complex pathway is involved in TGF-beta signaling.
21166929 2011 MEK5 is activated by shear stress, activates ERK5 and induces KLF4 to modulate TNF responses in human dermal microvascular endothelial cells.
21159640 2010 Prognostic value and function of KLF4 in prostate cancer: RNAa and vector-mediated overexpression identify KLF4 as an inhibitor of tumor cell growth and migration.
21132436 2011 The role of KLF4 in UVB-induced murine skin tumor development and its correlation with cyclin D1, p53, and p21(Waf1/Cip1) in epithelial tumors of the human skin.
21125297 2011 Longitudinal cell formation in the entire human small intestine is correlated with the localization of Hath1 and Klf4.
21075859 2010 Dopamine, by acting through its D2 receptor, inhibits insulin-like growth factor-I (IGF-I)-induced gastric cancer cell proliferation via up-regulation of Krüppel-like factor 4 through down-regulation of IGF-IR and AKT phosphorylation.
20972454 2011 Mutant p53 subverts p63 control over KLF4 expression in keratinocytes.
20849362 2011 Gene profiling of bone marrow- and adipose tissue-derived stromal cells: a key role of Kruppel-like factor 4 in cell fate regulation.
20727893 2010 KLF4? up-regulation promotes cell cycle progression and reduces survival time of patients with pancreatic cancer.
20718868 2010 Induction of Krüppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I.
20699379 2010 Expression of the tumor suppressor Krüppel-like factor 4 as a prognostic predictor for colon cancer.
20629177 2010 Krüppel-like transcription factor 4 contributes to maintenance of telomerase activity in stem cells.
20551324 2010 Erk5 activation elicits a vasoprotective endothelial phenotype via induction of Kruppel-like factor 4 (KLF4).
20519630 2010 KLF4 is a tumor suppressor in B-cell non-Hodgkin lymphoma and in classic Hodgkin lymphoma.
20479568 2010 Krüppel-like factor 4 mediates anti-proliferative effects of progesterone with G?/G? arrest in human endometrial epithelial cells.
20442780 2010 Differential control of Notch1 gene transcription by Klf4 and Sp3 transcription factors in normal versus cancer-derived keratinocytes.
20385121 2010 MCC-555-induced NAG-1 expression is mediated in part by KLF4.
20356845 2010 Kruppel-like factor 4 inhibits epithelial-to-mesenchymal transition through regulation of E-cadherin gene expression.
20215880 2010 KLF4 inhibition of lung cancer cell invasion by suppression of SPARC expression.
20075075 2010 MicroRNA-10b promotes migration and invasion through KLF4 in human esophageal cancer cell lines.
20072650 2010 Genetic and epigenetic inactivation of Kruppel-like factor 4 in medulloblastoma.
20071344 2010 Kruppel-like factor 4 (Klf4) prevents embryonic stem (ES) cell differentiation by regulating Nanog gene expression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20043075 2010 An 8-gene signature, including methylated and down-regulated glutathione peroxidase 3, of gastric cancer.
20030945 2009 [Effect of inflammatory cytokines on the expression of Krupple-like factor 4 in endothelium].
19968965 2010 Defining the regulation of KLF4 expression and its downstream transcriptional targets in vascular endothelial cells.
19858207 2009 Kruppel-like factor 4 is a novel mediator of Kallistatin in inhibiting endothelial inflammation via increased endothelial nitric-oxide synthase expression.
19816951 2009 Klf4 interacts directly with Oct4 and Sox2 to promote reprogramming.
19779097 Transgenic mice expressing constitutively active Akt in oral epithelium validate KLFA as a potential biomarker of head and neck squamous cell carcinoma.
19763260 2009 Two factor reprogramming of human neural stem cells into pluripotency.
19751731 2009 C-terminal binding proteins (CtBPs) attenuate KLF4-mediated transcriptional activation.
19737957 2009 Putative tumor-suppressive function of Kruppel-like factor 4 in primary lung carcinoma.
19717984 2009 Epithelial transformation by KLF4 requires Notch1 but not canonical Notch1 signaling.
19696409 2009 iPS programmed without c-MYC yield proficient cardiogenesis for functional heart chimerism.
19549847 2009 Stoichiometric and temporal requirements of Oct4, Sox2, Klf4, and c-Myc expression for efficient human iPSC induction and differentiation.
19544095 2009 KLF4 suppresses HDACi induced caspase activation and the SAPK pathway by targeting p57(Kip2).
19541842 2010 MicroRNA expression in human airway smooth muscle cells: role of miR-25 in regulation of airway smooth muscle phenotype.
19522013 2009 KLF4 and PBX1 directly regulate NANOG expression in human embryonic stem cells.
19505997 2009 The pluripotency transcription factor Krüppel-like factor 4 is strongly expressed in intratubular germ cell neoplasia unclassified and seminoma.
19503094 2009 KLF4 suppresses estrogen-dependent breast cancer growth by inhibiting the transcriptional activity of ERalpha.
19495417 2009 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b.
19458492 2009 Genes involved in regulation of stem cell properties: studies on their expression in a small cohort of neuroblastoma patients.
19409607 2009 MicroRNA-145 regulates OCT4, SOX2, and KLF4 and represses pluripotency in human embryonic stem cells.
19361279 Krüppel-like factor 4 represses transcription of the survivin gene in esophageal cancer cell lines.
19327128 2009 KLF4 positively regulates human ghrelin expression.
19197145 2009 Prevention of KLF4-mediated tumor initiation and malignant transformation by UAB30 rexinoid.
19074836 2008 Notch inhibits expression of the Krüppel-like factor 4 tumor suppressor in the intestinal epithelium.
18977346 2008 KLF4 regulation in intestinal epithelial cell maturation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18655026 2008 Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells.
18390749 2008 Kruppel-like factor 4 is essential for inflammatory monocyte differentiation in vivo.
18376139 2008 Nuclear Krüppel-like factor 4 expression is associated with human skin squamous cell carcinoma progression and metastasis.
18264726 2008 Dynamic down-regulation of Krüppel-like factor 4 in colorectal adenoma-carcinoma sequence.
18157115 2008 Reprogramming of human somatic cells to pluripotency with defined factors.
18056793 2008 Regulation of Kruppel-like factor 4, 9, and 13 genes and the steroidogenic genes LDLR, StAR, and CYP11A in ovarian granulosa cells.
18035408 2007 Induction of pluripotent stem cells from adult human fibroblasts by defined factors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932114 2007 Kruppel-like factor 4 expression in normal and pathological human testes.
17908689 2007 Kruppel-like factor 4 is acetylated by p300 and regulates gene transcription via modulation of histone acetylation.
17762869 2007 The Kruppel-like factor KLF4 is a critical regulator of monocyte differentiation.
17688680 2007 Analysis of KLF transcription factor family gene variants in type 2 diabetes.
17671182 2007 Haploinsufficiency of Krüppel-like factor 4 promotes adenomatous polyposis coli dependent intestinal tumorigenesis.
17614846 2007 Genetic and epigenetic analysis of the KLF4 gene in gastric cancer.
17508399 2007 The diverse functions of Krüppel-like factors 4 and 5 in epithelial biology and pathobiology.
17467953 2007 Nine-amino-acid transactivation domain: establishment and prediction utilities.
17339326 2007 Kruppel-like factor 4 regulates endothelial inflammation.
17308127 2007 Human mucin 1 oncoprotein represses transcription of the p53 tumor suppressor gene.
17135299 2007 Regulation of the human biotin transporter hSMVT promoter by KLF-4 and AP-2: confirmation of promoter activity in vivo.
17017123 2006 Transcriptional profiling of the cell cycle checkpoint gene krüppel-like factor 4 reveals a global inhibitory function in macromolecular biosynthesis.
17016435 2007 Krüppel-like factor 4 exhibits antiapoptotic activity following gamma-radiation-induced DNA damage.
16632465 2006 Regulation of cGMP-dependent protein kinase expression by Rho and Kruppel-like transcription factor-4.
16507986 2006 Novel cross talk of Kruppel-like factor 4 and beta-catenin regulates normal intestinal homeostasis and tumor repression.
16372018 2006 KLF4, p21 and context-dependent opposing forces in cancer.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15806166 2005 Krüppel-like factor 4 prevents centrosome amplification following gamma-irradiation-induced DNA damage.
15805274 2005 Drastic down-regulation of Krüppel-like factor 4 expression is critical in human gastric cancer development and progression.
15740636 2005 Krüppel-like factors 4 and 5: the yin and yang regulators of cellular proliferation.
15674344 2005 Induction of KLF4 in basal keratinocytes blocks the proliferation-differentiation switch and initiates squamous epithelial dysplasia.
15561714 2005 The leukocyte integrin gene CD11d is repressed by gut-enriched Kruppel-like factor 4 in myeloid cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15102675 2004 Nuclear localization of KLF4 is associated with an aggressive phenotype in early-stage breast cancer.
15051827 2004 Krüppel-like factor 4 is transactivated by butyrate in colon cancer cells.
15031282 2004 The Kruppel-like KLF4 transcription factor, a novel regulator of urokinase receptor expression, drives synthesis of this binding site in colonic crypt luminal surface epithelial cells.
14724568 2004 Identification of Krüppel-like factor 4 as a potential tumor suppressor gene in colorectal cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670968 2004 Kruppel-like factor 4 (KLF4) represses histidine decarboxylase gene expression through an upstream Sp1 site and downstream gastrin responsive elements.
14627709 2004 Requirement of Krüppel-like factor 4 in preventing entry into mitosis following DNA damage.
12919939 2004 Enterocyte differentiation marker intestinal alkaline phosphatase is a target gene of the gut-enriched Kruppel-like factor.
12901861 2003 Downregulation and growth inhibitory effect of epithelial-type Krüppel-like transcription factor KLF4, but not KLF5, in bladder cancer.
12853980 2003 Transcriptional regulation of A33 antigen expression by gut-enriched Krüppel-like factor.
12776194 2003 Overexpression of Krüppel-like factor 4 in the human colon cancer cell line RKO leads to reduced tumorigenecity.
12581631 2003 Transcriptional profiling of Krüppel-like factor 4 reveals a function in cell cycle regulation and epithelial differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439907 2002 Down-regulation of gut-enriched Kruppel-like factor expression in esophageal cancer.
12427745 2003 Kruppel-like factor 4 mediates p53-dependent G1/S cell cycle arrest in response to DNA damage.
12297499 2002 Gut-enriched Kruppel-like factor represses ornithine decarboxylase gene expression and functions as checkpoint regulator in colonic cancer cells.
12087155 2002 Opposing effects of Krüppel-like factor 4 (gut-enriched Krüppel-like factor) and Krüppel-like factor 5 (intestinal-enriched Krüppel-like factor) on the promoter of the Krüppel-like factor 4 gene.
11521200 2001 Expression of the gut-enriched Krüppel-like factor (Krüppel-like factor 4) gene in the human colon cancer cell line RKO is dependent on CDX2.
10749849 2000 The gut-enriched Kruppel-like factor (Kruppel-like factor 4) mediates the transactivating effect of p53 on the p21WAF1/Cip1 promoter.
10666450 2000 Transactivation and growth suppression by the gut-enriched Krüppel-like factor (Krüppel-like factor 4) are dependent on acidic amino acid residues and protein-protein interaction.
10556311 1999 Characterization of the structure and regulation of the murine gene encoding gut-enriched Krüppel-like factor (Krüppel-like factor 4).
10431239 1999 Klf4 is a transcription factor required for establishing the barrier function of the skin.
10392904 1999 Oncogene expression cloning by retroviral transduction of adenovirus E1A-immortalized rat kidney RK3E cells: transformation of a host with epithelial features by c-MYC and the zinc finger protein GKLF.
9651398 1998 The gut-enriched Krüppel-like factor suppresses the activity of the CYP1A1 promoter in an Sp1-dependent fashion.
9443972 1998 Identification of the DNA sequence that interacts with the gut-enriched Krüppel-like factor.
9428642 1997 Expression of the gut-enriched Krüppel-like factor gene during development and intestinal tumorigenesis.
9422764 1998 Human EZF, a Krüppel-like zinc finger protein, is expressed in vascular endothelial cells and contains transcriptional activation and repression domains.
9218496 1997 Two potent nuclear localization signals in the gut-enriched Krüppel-like factor define a subfamily of closely related Krüppel proteins.
8940147 1996 A gene for a novel zinc-finger protein expressed in differentiated epithelial cells and transiently in certain mesenchymal cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702718 1996 Identification and characterization of a gene encoding a gut-enriched Krüppel-like factor expressed during growth arrest.