Property Summary

NCBI Gene PubMed Count 27
PubMed Score 35.34
PubTator Score 18.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.344 2.8e-05
Astrocytoma, Pilocytic 1.400 1.4e-07
atypical teratoid / rhabdoid tumor 1.300 6.0e-05
Breast cancer 2.200 3.5e-02
chronic lymphosyte leukemia -1.600 3.6e-03
ependymoma 1.200 2.5e-02
glioblastoma 1.300 1.8e-03
group 4 medulloblastoma 1.900 1.2e-03
interstitial cystitis -1.400 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
juvenile dermatomyositis 1.065 1.4e-08
lung adenocarcinoma -1.200 2.8e-10
medulloblastoma, large-cell 1.300 5.8e-05
oligodendroglioma 1.400 6.1e-03
ovarian cancer -2.400 1.6e-07
pancreatic cancer 1.100 1.3e-02
pediatric high grade glioma 1.300 8.6e-06
primary pancreatic ductal adenocarcinoma 1.144 1.2e-02
spina bifida -1.608 2.8e-02
tuberculosis and treatment for 6 months 1.100 7.1e-05

Gene RIF (12)

AA Sequence

MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRS      1 - 70
SPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPG     71 - 140
ILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRTDY    141 - 210
YPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAH    211 - 280
RRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV         281 - 345
//

Text Mined References (33)

PMID Year Title