Property Summary

NCBI Gene PubMed Count 102
PubMed Score 188.63
PubTator Score 126.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Barrett's esophagus 1.300 2.7e-02
astrocytoma 1.100 8.9e-03
medulloblastoma, large-cell -1.600 5.4e-05
adrenocortical carcinoma -1.129 2.5e-03
primary pancreatic ductal adenocarcinoma 1.465 1.4e-02
non-small cell lung cancer -2.492 2.2e-24
intraductal papillary-mucinous adenoma (... 1.900 1.2e-03
lung cancer -3.500 1.1e-05
breast carcinoma -1.200 6.9e-04
fibroadenoma -1.700 1.0e-02
group 4 medulloblastoma -1.300 2.9e-04
lung adenocarcinoma -2.600 4.8e-12
psoriasis -1.900 1.7e-13
invasive ductal carcinoma -1.100 2.6e-02
ulcerative colitis 2.100 5.9e-07
ovarian cancer -3.400 7.5e-17
chronic rhinosinusitis -1.358 2.4e-02
pancreatic cancer 1.300 3.4e-02

 GO Component (1)

Gene RIF (94)

PMID Text
27027284 studies identify gain of MEKK3 signalling and KLF2/4 function as causal mechanisms for cerebral cavernous malformations pathogenesis that may be targeted to develop new CCM therapeutics
26853883 our data highlight an important role for KLF2/c-myc pathway in HCC development and progression.
26728187 These results indicate that the KDM3A-KLF2-IRF4 pathway plays an essential role in multiple myeloma cell survival and homing to the bone marrow, and therefore represents a therapeutic target.
26717516 These data provide support for a continuous role of KLF2 in stabilizing the vessel wall via co-temporal expression of eNOS and AQP1 both preceding and during the pathogenesis of atherosclerosis.
26456066 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of Ang2.
26416422 Authors show that KLF2 induces the expression of CRABP2 and RARgamma and inhibits the expression FABP5 and PPARbeta/delta thereby shifting RA signaling from the pro-carcinogenic FABP5/PPARbeta/delta to the growth-suppressing CRABP2/RAR path.
26372274 Expression of KLF4 in mononuclear leukocytes positively correlates with cellular markers of immune activation, whereas KLF2 expression negatively correlates with markers of subclinical atherosclerosis in this HIV-infected population.
26336870 TUG1 overexpression was induced by nuclear transcription factor SP1 and TUG1 could epigeneticly repress Kruppel-like factor 2 (KLF2) transcription in HCC cells by binding with PRC2 and recruiting it to KLF2 promoter region.
26299712 In hyperuricemia, miR-92a downregulation increased KLF2 expression, subsequently inhibiting VEGFA, which resulted in decreased angiogenesis.
26212440 In conclusion, KLF2 suppressed the angiogenesis of LSECs through inhibition of cell proliferation, migration, and vessel tube formation.
25966845 We showed that ANRIL may regulate the proliferation ability of HCC cells partially through silencing of KLF2
25728677 TINCR could bind to STAU1 (staufen1) protein, and influence KLF2 mRNA stability and expression
25694435 results suggest that KLF2 is involved in strict repression of hTERT expression through binding to the promoter in primary human T cells
25672609 Upregulation of SUZ12 was found to play a key role in gastric cancer cell proliferation and metastasis through the regulation of EMT and KLF2 expression
25646266 ICOS maintains the T follicular helper cell phenotype by down-regulating Kruppel-like factor 2.
25542418 Data suggest that KLF2 is involved in regulation of gene expression in vascular endothelium by dietary factors (here, effects of flavonoids on gene expression in cultured umbilical vein endothelial cells).
25504755 Results show that lncRNA ANRIL plays a key role in non-small cell lung cancer (NSCLC) development by associating its expression with survival in patients with NSCLC through silencing of KLF2 and P21 transcription.
25501704 Our findings present that decreased KLF2 could be identified as a poor prognostic biomarker in NSCLC and regulate cell proliferation and apoptosis
25428260 KLF2 mutation is the most common genetic change in splenic marginal zone lymphoma
25388666 Provide first evidence for existence of a previously unknown Erk5/KLF2/PAK1 axis, which may limit undesired cell migration in unperturbed endothelium and lower its sensitivity for migratory cues that promote vascular diseases including atherosclerosis.
25359860 Shear stress-mediated repression of endothelial cell metabolism via KLF2 and PFKFB3 controls endothelial cell phenotype.
25330112 Here we report that HIV-1 down-modulates CD62L in productively infected naive and memory resting CD4 T cells while suppressing Foxo1 activity and the expression of KLF2 mRNA.
25283840 KLF2 transcription factor gene is recurrently mutated in splenic marginal zone lymphoma
25096223 Data reveal a novel role of HDAC5 in modulating the KLF2 transcriptional activation and eNOS expression.
25039491 IKKbeta regulates endothelial thrombomodulin in a Klf2-dependent manner
24801208 Knockdown of KLF2 or HO-1 abrogated effects of statins on HCV replication.
24107715 The observations identify KLF2 as a novel negative regulator of DC function and it may play an essential role in DC activation in ACS.
23723375 Downregulation of KLF2 by LDL leads to a dysfunctional, hypercoagulable endothelium.
23667185 Overexpression of KLF2 promoted endothelial cell differentiation by enhancing expression of endothelial cell markers, reducing expression of progenitor cell markers, and increasing tube formation, indicating the important role of KLF2 in angiogenesis.
23507969 The siRNA-mediated knockdown of FBW7 showed that KLF2 is an essential target of FBW7 in the regulation of endothelial functions.
23333304 HIV-1 Vif downregulates the expression of Kruppel-like factor 2 (KLF2) in Vif-expression T cells
23313511 this is the first time to report that KLF2 is involved in cerebrovascular dysfunction in Alzheimer's disease.
23002242 High-glucose-induced, FOXO1-mediated KLF2 suppression was reversed by atorvastatin, suggesting that intensive statin treatment could be a therapeutic option in diabetic vascular dysfunction.
22988032 KLF2 is a host transcription factor that modulates C-C chemokine receptor (CCR)5 expression in CD4 T cells by influencing susceptibility to infection with CCR5 receptor-dependent HIV-1 strains.
22942434 Conditional B1 phenotype B cells are present in neonatal mice with B cell-specific KLF2 deficiency, suggesting that B1 differentiation can occur even in the absence of KLF2.
22715381 These data suggest that KLF2 expression leads to a change in size and composition of the regulated secretory compartment of endothelial cells and alters its response to physiological stimuli
22683691 exposure of glomerular endothelial cells to chronic (>24h) LSS of 10 dyn/cm(2) increases phosphorylation of extra-cellular signal-related kinase 5 (ERK5) and increases expression of KLF2
22574900 Neovascularization is induced in duodenal tissue of patients with cirrhosis and proangiogenic factors such as KLF-2, Ang-2, miR-126 and VEGF can contribute to the angiogenesis induced by hemodynamic forces.
22327366 Data show that extracellular vesicles secreted by KLF2-transduced or shear-stress-stimulated umbilical vein endothelial cells (HUVECs) are enriched in miR-143/145 and control target gene expression in co-cultured smooth muscle cell (SMC).
22267843 Thioredoxin interacting protein promotes endothelial cell inflammation in response to disturbed flow by increasing leukocyte adhesion and repressing Kruppel-like factor 2.
22267480 miR-92a coregulates KLF4 and KLF2 expression in arterial endothelium and contributes to phenotype heterogeneity associated with regional atherosusceptibility and protection in vivo.
22143796 Dopamine stabilizes tumor blood vessels by up-regulating angiopoietin 1 expression in pericytes and Kruppel-like factor-2 expression in tumor endothelial cells
21768538 Atheroprotective flow patterns decrease the level of miR-92a, which in turn increases KLF2 expression to maintain endothelial homeostasis.
21610079 KLF1 and KLF2 positively regulate the embryonic and fetal beta-globin genes through direct promoter binding.
21470678 Low KLF2 is associated with acute myeloid leukemia.
21382345 This study provided the first evidence that Smurf1 functions as an E3 ligase to promote the ubiquitination and proteasomal degradation of KLF2.
21187410 KLF2 plays a critical role in dictating normal subset differentiation and functional reactivity of mature B cells
21167486 Kruppel-like factor 2 is involved in the enhanced secretion of MCP-1 by M2 macrophages loaded with oxidized LDL.
21160050 Transgenic KLF2-deficient T cells show dysregulated trafficking but not altered proliferative characteristics following in vivo responses to antigen.
20947822 Report a novel p53-dependent mechanism for the regulation of endothelial KLF2 expression. Downregulation of KLF2, in part, mediates a p53-stimulated dysfunctional endothelium.
20693579 Data suggest that inhibition of differentiation of human adipose tissue-derived stem cells by UVA occurs primarily through reduced expression of PPAR gamma, which is mediated by up-regulation of KLF2 via activation of MIF-AMP-activated protein kinase.
20651277 KLF2 confers barrier-protection via differential effects on the expression of key junction protein occludin and modification of a signaling molecule (myosin light chain) that regulate endothelial barrier integrity.
20525885 Bacterial pneumococci induce KLF2 expression in human epithelial BEAS-2B cells in vitro, thus contributing to the control of proinflammatory gene expression.
20042720 phosphorylation-dependent derepression of HDAC5 mediates flow-induced KLF2 and eNOS expression as well as flow anti-inflammation, and suggest that HDAC5 could be a potential therapeutic target for the prevention of atherosclerosis.
20032497 findings link the specific effects of shear-induced KLF2 on endothelial morphology to the suppression of JNK MAPK signaling in vascular homeostasis via novel actin shear fibers
19968965 these data identify a significant degree of mechanistic and functional conservation between KLF2 and KLF4, and importantly, provide further insights into the complex regulatory networks governing endothelial vasoprotection.
19957349 The ratio of proinflammatory factor RelA (NFkappaB/p65) to anti-inflammatory factor KLF2 (Kruppel-like factor 2) was greater in blood outgrowth endothelial cells of Sickle cell patients at risk of stroke
19786564 Short hairpin RNA-mediated inactivation of RhoA and its effector rhophilin 1 is sufficient to induce long-term klf2 expression by several bacterial toxins.
19696221 These findings illustrate a novel mechanism by which p66shc promotes cellular oxidative stress, through suppression of MEF2A expression and consequent repression of KLF2 transcription.
19671192 Data show that the use of siRNA against KLF2 led to an upregulation of CXCR4 mRNA.
19495417 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b
19491109 KLF2 is a novel inhibitor of HIF-1alpha expression and function.
19047056 KLF2-expressing EC co-cultured with SMC significantly reduce SMC migration compared with control EC and that this reduction can be rescued by the addition of exogenous connective tissue growth factor.
18976975 Knockdown of Kruppel-like factor 2 (KLF2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18814951 downregulation of antiinflammatory factors, such as TNFAIP3, KLF2, ZFP36, and BTG1, seems to be involved in acceleration of immune response, thus exacerbation of acute GVHD.
18467642 KLF2 substantially enhances antioxidant activity of Nrf2 by increasing its nuclear localization and activation.
18362151 up-regulation of CD59 via ERK5/KLF2 activation leads to endothelial resistance to complement-mediated injury and protects from atherogenesis in regions of laminar shear stress
18218994 Data suggest that, in neutrophil-dominated airway environments, such as that seen in cystic fibrosis, reduced LKLF activity releases a brake on pro-inflammatory cytokine production and may contribute to the inflammatory responses seen in CF.
18192240 Simvastatin has a strong anti-inflammatory effect on monocytes including upregulation of the atheroprotective factor KLF-2.
17927807 Atorvastatin-mediated HO-1 upregulation, and its associated antioxidant effect, are KLF2-dependent.
17688680 Observational study of gene-disease association. (HuGE Navigator)
17688680 analysis of SNPs, located in the KLF2, KLF4 and KLF5 gene did not show an association with Type 2 diabetes in this French population
17244683 Shear stress and KLF2 inhibit nuclear activity of ATF2, providing a potential mechanism by which endothelial cells exposed to laminar flow are protected from basal proinflammatory, atherogenic gene expression.
16988269 Human transcription factors KLF2 and KLF6 are targets of the P. aeruginosa type III exoenzymes S and Y, with potential importance in host cell death.
16617118 KLF2 expression in circulating monocytes is reduced in patients with chronic inflammatory conditions such as coronary artery disease.
16571724 nucleolin binds the KLF2 promoter
16542423 Observational study of gene-disease association. (HuGE Navigator)
16466697 findings demonstrate that different flow patterns differentially regulate the expression of KLF2 and that KLF2 has an anti-apoptotic effect
16455954 KLF2 acts as a central transcriptional switch point between the quiescent and activated states of the adult endothelial cell
16341264 KLF2 is selectively induced in endotheliums by atheroprotective flow via a MEK5/ERK5/MEF2 signaling pathway. Expression of KLF2 results in the regulation of endothelial programs controlling inflammation, thrombosis, vascular tone, and angiogenesis.
16116194 KLF2 regulates IL-2 promoter activity in the earliest stages of T cell activation.
16043642 Statin-dependent induction of eNOS and thrombomodulin requires KLF2 and thereby provides a novel molecular target for modulating endothelial function in vascular disease.
16023392 In co-transfection assays in K562 cells, it was demonstrated that KLF2, 5 and 13 positively regulate, and KLF8 negatively regulates, the gamma-globin gene through the CACCC promoter element.
15980434 KLF2 is a regulator of VEGFR2/KDR and has a role in regulating angiogenesis
15947087 KLF2 has roles in primitive erythropoiesis and regulating human and murine embryonic beta-like globin genes
15937668 Observational study of gene-disease association. (HuGE Navigator)
15878865 demonstrated that KLF2 transcription factor is necessary for the statin-mediated regulation of several pathophysiologically relevant genes
15834135 a promoter element activated by a PI3kinase-dependent chromatin-remodeling pathway induces KLF2
15735666 Level of WEE1 is regulated by KLF2 and enhanced KLF2 expression sensitizes cells to DNA damage-induced apoptosis.
15718498 The ability to differentially modulate key molecules such as TM, eNOS, PAI-1, & TF identifies KLF2 as an important regulator of endothelial coagulant function. KLF2 is a "molecular switch" regulating important aspects of vascular function.
15607822 LKLF may establish a phenotype that primes quiescent cells for responses to specific extracellular stimuli.
15136591 KLF2 is a novel regulator of endothelial activation in response to proinflammatory stimuli.
12426306 KLF2 has a role as a negative regulator of adipogenesis
12176889 LKLF is the first endothelial transcription factor that is uniquely induced by flow and might therefore be at the molecular basis of the physiological healthy, flow-exposed state of the endothelial cell

AA Sequence

MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPP      1 - 70
PAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGL     71 - 140
TRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLH    141 - 210
YAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCG    211 - 280
KTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH    281 - 350
MKRHM                                                                     351 - 355
//

Text Mined References (103)

PMID Year Title
27027284 2016 Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling.
26853883 2016 Krüppel-like factor 2 promotes cell proliferation in hepatocellular carcinoma through up-regulation of c-myc.
26728187 2016 The KDM3A-KLF2-IRF4 axis maintains myeloma cell survival.
26717516 2015 Expression of Nitric Oxide-Transporting Aquaporin-1 Is Controlled by KLF2 and Marks Non-Activated Endothelium In Vivo.
26456066 2015 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of angiopoietin 2.
26416422 2015 Kruppel-like factor 2 suppresses mammary carcinoma growth by regulating retinoic acid signaling.
26372274 2015 HIV vasculopathy: role of mononuclear cell-associated Krüppel-like factors 2 and 4.
26336870 2015 Long non-coding RNA TUG1 is up-regulated in hepatocellular carcinoma and promotes cell growth and apoptosis by epigenetically silencing of KLF2.
26299712 2015 High concentrations of uric acid inhibit angiogenesis via regulation of the Krüppel-like factor 2-vascular endothelial growth factor-A axis by miR-92a.
26212440 2015 Kruppel-like factor 2 inhibit the angiogenesis of cultured human liver sinusoidal endothelial cells through the ERK1/2 signaling pathway.
25966845 2015 Long non-coding RNA ANRIL is upregulated in hepatocellular carcinoma and regulates cell apoptosis by epigenetic silencing of KLF2.
25728677 2015 SP1-induced upregulation of the long noncoding RNA TINCR regulates cell proliferation and apoptosis by affecting KLF2 mRNA stability in gastric cancer.
25694435 2015 Krüppel-like factor 2 represses transcription of the telomerase catalytic subunit human telomerase reverse transcriptase (hTERT) in human T cells.
25672609 2015 SUZ12 promotes gastric cancer cell proliferation and metastasis by regulating KLF2 and E-cadherin.
25646266 2015 ICOS maintains the T follicular helper cell phenotype by down-regulating Krüppel-like factor 2.
25542418 2015 Regulation of vascular endothelial genes by dietary flavonoids: structure-expression relationship studies and the role of the transcription factor KLF-2.
25504755 2015 Long noncoding RNA ANRIL promotes non-small cell lung cancer cell proliferation and inhibits apoptosis by silencing KLF2 and P21 expression.
25501704 2015 Downregulation of Kruppel-like factor 2 is associated with poor prognosis for nonsmall-cell lung cancer.
25428260 2015 KLF2 mutation is the most frequent somatic change in splenic marginal zone lymphoma and identifies a subset with distinct genotype.
25388666 2015 Erk5 inhibits endothelial migration via KLF2-dependent down-regulation of PAK1.
25359860 2015 Laminar shear stress inhibits endothelial cell metabolism via KLF2-mediated repression of PFKFB3.
25330112 2014 Suppression of Foxo1 activity and down-modulation of CD62L (L-selectin) in HIV-1 infected resting CD4 T cells.
25283840 2015 The Krüppel-like factor 2 transcription factor gene is recurrently mutated in splenic marginal zone lymphoma.
25096223 2014 Histone deacetylase 5 interacts with Krüppel-like factor 2 and inhibits its transcriptional activity in endothelium.
25039491 2014 IKK? regulates endothelial thrombomodulin in a Klf2-dependent manner.
24801208 2014 Matrix conditions and KLF2-dependent induction of heme oxygenase-1 modulate inhibition of HCV replication by fluvastatin.
24107715 2013 Kruppel-like factor 2 regulates dendritic cell activation in patients with acute coronary syndrome.
23723375 2013 Histone and DNA methylation-mediated epigenetic downregulation of endothelial Kruppel-like factor 2 by low-density lipoprotein cholesterol.
23667185 2013 Transcription factor Krüppel-like factor 2 plays a vital role in endothelial colony forming cells differentiation.
23507969 2013 FBW7 regulates endothelial functions by targeting KLF2 for ubiquitination and degradation.
23313511 2013 A?(1-42) disrupts the expression and function of KLF2 in Alzheimer's disease mediated by p53.
23043106 2012 Laminar flow activation of ERK5 protein in vascular endothelium leads to atheroprotective effect via NF-E2-related factor 2 (Nrf2) activation.
23002242 2013 FOXO1 impairs whereas statin protects endothelial function in diabetes through reciprocal regulation of Kruppel-like factor 2.
22988032 2012 Kruppel-like factor 2 modulates CCR5 expression and susceptibility to HIV-1 infection.
22942434 2012 Cutting edge: Kr?ppel-like factor 2 is required for phenotypic maintenance but not development of B1 B cells.
22715381 2012 The shear stress-induced transcription factor KLF2 affects dynamics and angiopoietin-2 content of Weibel-Palade bodies.
22683691 2012 Chronic exposure to laminar shear stress induces Kruppel-like factor 2 in glomerular endothelial cells and modulates interactions with co-cultured podocytes.
22574900 2012 Angiogenesis within the duodenum of patients with cirrhosis is modulated by mechanosensitive Kruppel-like factor 2 and microRNA-126.
22327366 2012 Atheroprotective communication between endothelial cells and smooth muscle cells through miRNAs.
22267843 2012 Thioredoxin interacting protein promotes endothelial cell inflammation in response to disturbed flow by increasing leukocyte adhesion and repressing Kruppel-like factor 2.
22267480 2012 Site-specific microRNA-92a regulation of Kruppel-like factors 4 and 2 in atherosusceptible endothelium.
22143796 2011 Dopamine stabilizes tumor blood vessels by up-regulating angiopoietin 1 expression in pericytes and Kruppel-like factor-2 expression in tumor endothelial cells.
21768538 2011 Flow-Dependent Regulation of Kruppel-Like Factor 2 Is Mediated by MicroRNA-92a.
21610079 2011 Transcription factors KLF1 and KLF2 positively regulate embryonic and fetal beta-globin genes through direct promoter binding.
21470678 2011 Deregulated expression of Kruppel-like factors in acute myeloid leukemia.
21382345 2011 Smurf1 ubiquitin ligase targets Kruppel-like factor KLF2 for ubiquitination and degradation in human lung cancer H1299 cells.
21187410 2011 Krüppel-like factor 2 (KLF2) regulates B-cell reactivity, subset differentiation, and trafficking molecule expression.
21167486 2011 Oxidized LDL enhances pro-inflammatory responses of alternatively activated M2 macrophages: a crucial role for Krüppel-like factor 2.
21160050 2011 Kruppel-like factor 2 is required for trafficking but not quiescence in postactivated T cells.
21063504 2010 A novel role of CCN3 in regulating endothelial inflammation.
20947822 2011 p53 impairs endothelial function by transcriptionally repressing Kruppel-Like Factor 2.
20693579 2010 Ultraviolet A regulates adipogenic differentiation of human adipose tissue-derived mesenchymal stem cells via up-regulation of Kruppel-like factor 2.
20651277 2010 Kruppel-like factor 2 regulates endothelial barrier function.
20551324 2010 Erk5 activation elicits a vasoprotective endothelial phenotype via induction of Kruppel-like factor 4 (KLF4).
20525885 2010 TLR2- and nucleotide-binding oligomerization domain 2-dependent Krüppel-like factor 2 expression downregulates NF-kappa B-related gene expression.
20042720 2010 Fluid shear stress stimulates phosphorylation-dependent nuclear export of HDAC5 and mediates expression of KLF2 and eNOS.
20032497 2010 KLF2-induced actin shear fibers control both alignment to flow and JNK signaling in vascular endothelium.
19968965 2010 Defining the regulation of KLF4 expression and its downstream transcriptional targets in vascular endothelial cells.
19957349 2010 Proinflammatory phenotype with imbalance of KLF2 and RelA: risk of childhood stroke with sickle cell anemia.
19786564 2009 Bacterial toxins induce sustained mRNA expression of the silencing transcription factor klf2 via inactivation of RhoA and Rhophilin 1.
19696221 2009 Transcriptional repression of Kruppel like factor-2 by the adaptor protein p66shc.
19671192 2009 Vesnarinone downregulates CXCR4 expression via upregulation of Krüppel-like factor 2 in oral cancer cells.
19592277 2009 KLF2 transcription-factor deficiency in T cells results in unrestrained cytokine production and upregulation of bystander chemokine receptors.
19495417 2009 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b.
19491109 2009 Kruppel-like factor 2 inhibits hypoxia-inducible factor 1alpha expression and function in the endothelium.
19047056 2009 Biomechanical Regulation of Endothelium-dependent Events Critical for Adaptive Remodeling.
18814951 2008 Gene-expression profiles of peripheral blood mononuclear cell subpopulations in acute graft-vs-host disease following cord blood transplantation.
18467642 2008 KLF2 primes the antioxidant transcription factor Nrf2 for activation in endothelial cells.
18362151 2008 KLF2-dependent, shear stress-induced expression of CD59: a novel cytoprotective mechanism against complement-mediated injury in the vasculature.
18218994 2008 Abrogation of anti-inflammatory transcription factor LKLF in neutrophil-dominated airways.
18192240 2008 Simvastatin has an anti-inflammatory effect on macrophages via upregulation of an atheroprotective transcription factor, Kruppel-like factor 2.
17927807 2007 Statin-mediated cytoprotection of human vascular endothelial cells: a role for Kruppel-like factor 2-dependent induction of heme oxygenase-1.
17688680 2007 Analysis of KLF transcription factor family gene variants in type 2 diabetes.
17244683 2007 Prolonged shear stress and KLF2 suppress constitutive proinflammatory transcription through inhibition of ATF2.
16988269 2006 Pseudomonas aeruginosa infection of airway epithelial cells modulates expression of Kruppel-like factors 2 and 6 via RsmA-mediated regulation of type III exoenzymes S and Y.
16617118 2006 Kruppel-like factor 2 (KLF2) regulates proinflammatory activation of monocytes.
16571724 2006 Up-regulation of the KLF2 transcription factor by fluid shear stress requires nucleolin.
16542423 2006 A study of the relationships between KLF2 polymorphisms and body weight control in a French population.
16466697 2006 Shear stress regulation of Krüppel-like factor 2 expression is flow pattern-specific.
16455954 2006 KLF2 provokes a gene expression pattern that establishes functional quiescent differentiation of the endothelium.
16341264 2006 Integration of flow-dependent endothelial phenotypes by Kruppel-like factor 2.
16116194 2005 Krüppel-like factor 2, a novel immediate-early transcriptional factor, regulates IL-2 expression in T lymphocyte activation.
16043642 2005 Kruppel-like factor 2 as a novel mediator of statin effects in endothelial cells.
16023392 A functional screen for Krüppel-like factors that regulate the human gamma-globin gene through the CACCC promoter element.
15980434 2005 Inhibition of vascular permeability factor/vascular endothelial growth factor-mediated angiogenesis by the Kruppel-like factor KLF2.
15947087 2005 KLF2 is essential for primitive erythropoiesis and regulates the human and murine embryonic beta-like globin genes in vivo.
15937668 2005 Single nucleotide polymorphisms in the gene encoding Krüppel-like factor 7 are associated with type 2 diabetes.
15878865 2005 Statins exert endothelial atheroprotective effects via the KLF2 transcription factor.
15834135 2005 Induction of KLF2 by fluid shear stress requires a novel promoter element activated by a phosphatidylinositol 3-kinase-dependent chromatin-remodeling pathway.
15735666 2005 Transcriptional repression of WEE1 by Kruppel-like factor 2 is involved in DNA damage-induced apoptosis.
15718498 2005 Kruppel-like factor 2 (KLF2) regulates endothelial thrombotic function.
15607822 2005 Identification of LKLF-regulated genes in quiescent CD4+ T lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15136591 2004 KLF2 Is a novel transcriptional regulator of endothelial proinflammatory activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426306 2003 The Krüppel-like factor KLF2 inhibits peroxisome proliferator-activated receptor-gamma expression and adipogenesis.
12176889 2002 Prolonged fluid shear stress induces a distinct set of endothelial cell genes, most specifically lung Krüppel-like factor (KLF2).
11750135 2001 Regulation of the vav proto-oncogene by LKLF.
11375995 2001 Lung Krüppel-like factor contains an autoinhibitory domain that regulates its transcriptional activation by binding WWP1, an E3 ubiquitin ligase.
10458913 1999 cDNA isolation, genomic structure, regulation, and chromosomal localization of human lung Kruppel-like factor.
10217429 1999 Structure of the human CpG-island-containing lung Kruppel-like factor (LKLF) gene and its location in chromosome 19p13.11-13 locus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7565748 1995 Isolation of a gene encoding a functional zinc finger protein homologous to erythroid Krüppel-like factor: identification of a new multigene family.