Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.85
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 2.7e-08
Disease Target Count Z-score Confidence
Van der Woude syndrome 9 3.093 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.500 2.7e-08

Gene RIF (16)

PMID Text
27107895 Enhanced KLF17 expression sensitizes ERalpha-positive breast cancer cells to endocrine therapy.KLF17-ERalpha interaction plays a potential role in inhibition of ERalpha-dependent breast cancer progression.
26617836 Suggest that KLF17 inhibits esophageal carcinoma development and may serve as a potential therapeutic target.
25911104 Tumor-suppressive p53 signaling is critical for KLF17 to inhibit cancer metastasis in Non-small Cell Lung Cancer.
25766320 KLF17 empowers TGF-beta/Smad signaling by targeting Smad3-dependent pathway to suppress tumor growth and metastasis during cancer progression.
25706482 A small subset of Myoepithelial tumors harbor FUS rearrangements, two thirds of them being associated with KLF17 fusion.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25111898 mutant p53 enhances cancer progression by inhibiting KLF17 expression in invasive breast carcinoma cells
25109837 The reduced expression of KLF17 promoted the motility and proliferation ability of TPC1 cells by altering the expression of tight junction protein 1 and Snai1, and activating the AKT pathway by upregulating inhibitor of DNA binding 1.
24947617 The reduced expression of KLF17 protein in gastric cancer was correlated with tumor size, pN stage and lymphovascular invasion and was an independent predictor for poor survival in patients undergoing surgery for gastric cancer.
24504364 KLF17 might be one of the downstream signalling molecules of DJ-1.
24220291 KLF17 may have an oncogenic role during EEC progression via initiating EMT through the regulation of TWIST1
23325444 Overall, these findings suggest a repressing role of KLF17 in tumor invasion
22240024 it is possible that KLF17 inhibits tumor growth in lung adenocarcinoma.
19951400 KLF17 has a role in transcriptional regulation of metastasis by Id1 [review]
19801974 demonstrate that KLF17 expression is significantly downregulated in primary human breast cancer samples and that the combined expression pattern of KLF17 and Id1 can serve as a potential biomarker for lymph node metastasis in breast cancer
16460907 KLF17 is a new member of the Sp/KLF family of transcription factors.

AA Sequence

MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGS      1 - 70
PLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNI     71 - 140
PRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQ    141 - 210
MLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEA    211 - 280
RPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSR    281 - 350
EFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP                                   351 - 389
//

Text Mined References (23)

PMID Year Title
27107895 2016 KLF17 attenuates estrogen receptor ?-mediated signaling by impeding ER? function on chromatin and determines response to endocrine therapy.
26617836 2015 Low expression of KLF17 is associated with tumor invasion in esophageal carcinoma.
25911104 2015 Tumor-suppressive p53 Signaling Empowers Metastatic Inhibitor KLF17-dependent Transcription to Overcome Tumorigenesis in Non-small Cell Lung Cancer.
25766320 2015 KLF17 empowers TGF-?/Smad signaling by targeting Smad3-dependent pathway to suppress tumor growth and metastasis during cancer progression.
25706482 2015 Novel FUS-KLF17 and EWSR1-KLF17 fusions in myoepithelial tumors.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25111898 2014 Gain-of-function of mutant p53: mutant p53 enhances cancer progression by inhibiting KLF17 expression in invasive breast carcinoma cells.
25109837 2014 Suppressed Krüppel?like factor 17 expression induces tumor proliferation, metastasis and a poor prognosis in papillary thyroid carcinoma.
24947617 2014 Reduced Krüppel-like factor 17 (KLF17) expression correlates with poor survival in patients with gastric cancer.
24504364 2014 DJ-1 upregulates breast cancer cell invasion by repressing KLF17 expression.
24220291 2014 Identification of KLF17 as a novel epithelial to mesenchymal transition inducer via direct activation of TWIST1 in endometrioid endometrial cancer.
23325444 2013 Down-regulated KLF17 expression is associated with tumor invasion and poor prognosis in hepatocellular carcinoma.
22240024 2012 Reduced expression of Krüppel-like factor 17 is related to tumor growth and poor prognosis in lung adenocarcinoma.
19951400 2009 Transcriptional regulation of metastatic [Id]entity by KLF17.
19801974 2009 KLF17 is a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16460907 2006 Human KLF17 is a new member of the Sp/KLF family of transcription factors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351194 2002 Identification of Zfp393, a germ cell-specific gene encoding a novel zinc finger protein.